Gene Information

Name : Nos7107_1198 (Nos7107_1198)
Accession : YP_007048998.1
Strain : Nostoc sp. PCC 7107
Genome accession: NC_019676
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1388635 - 1389309 bp
Length : 675 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: naz:Aazo_0389

DNA sequence :
ATGACACACATCTTACTTGTAGAAGATGAGGTCAAACTGGCGCGATTCATCGAATTGGAACTGAATTACGAAGGTTATCA
AGTCAGTGTCGCCTACGATGGATTAACTGCGCTTACTGCGGCGCGGGAATTACATCCAGATTTAGTTATTTTAGATTGGA
TGTTACCTGGGTTATCAGGATTAGAAATTTGCCGTCGCCTACGGAGTACTGGTGATAAAGTCCCAGTAATATTATTAACT
GCTAAAGATGAAGTCAGCGATCGCGTTGCCGGTTTAGATGCTGGTGCTGATGATTATGTAGTAAAACCGTTTAGCGTTGA
AGAACTCTTAGCCAGAGTCCGCGCTCATCTGCGTCGCAATCAAGAAGCAGACGCAGCAGATATCTTAGAATTTGAAGACC
TCAGCTTAAATCGCCGGACTAGAGAAGTTTATCGCGGCAATAGATTAATTGAATTAACCGCCAAAGAATTTGACTTGCTC
GATTATTTACTTTCCCATCCCCGACAGGTAATTACCCGCGATCGCATTTTAGAAGAAGTCTGGGGTTACGACTTTATGGG
CGATTCCAACATTATCGAAGTTTACGTCCGTTACTTGCGCCTCAAACTCGAAATCAATCAAGAAAAGCGCCTGATTCAAA
CCGTCCGAGGTGTTGGCTACGTCCTACGAGAGTAG

Protein sequence :
MTHILLVEDEVKLARFIELELNYEGYQVSVAYDGLTALTAARELHPDLVILDWMLPGLSGLEICRRLRSTGDKVPVILLT
AKDEVSDRVAGLDAGADDYVVKPFSVEELLARVRAHLRRNQEADAADILEFEDLSLNRRTREVYRGNRLIELTAKEFDLL
DYLLSHPRQVITRDRILEEVWGYDFMGDSNIIEVYVRYLRLKLEINQEKRLIQTVRGVGYVLRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-34 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-44 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-50 50
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-40 48
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-44 47
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0308 Protein 8e-39 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-43 46
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-36 45
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-40 45
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-37 44
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-38 44
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-35 44
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-32 44
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-37 43
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 8e-33 42
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-42 42
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-34 42
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-27 42
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-56 56
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-35 47
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-47 45
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-41 45
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator VFG1563 Protein 9e-32 41
Nos7107_1198 YP_007048998.1 winged helix family two component transcriptional regulator VFG1702 Protein 9e-32 41