Gene Information

Name : Cyagr_2371 (Cyagr_2371)
Accession : YP_007046818.1
Strain : Cyanobium gracile PCC 6307
Genome accession: NC_019675
Putative virulence/resistance : Resistance
Product : acetyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2294312 - 2294782 bp
Length : 471 bp
Strand : -
Note : PFAM: Acetyltransferase (GNAT) family; manually curated

DNA sequence :
GTGAACGCTCCCCCTTCGATCCGGCTCCTCGGCGCCTCTGACGCACCGGCCCTCCGCCAGATGCTGGGGCTCTTCAGCGA
GGCCTTCGACGACCCCGAGTCCTACCTCAACCATCAACCCAGCGACGCCTACCTCACCAGGCTCCTGGCCAGCGACACCT
TCATCGCCGTCGCCGCCTTCGCGGCAGGTCAGGTTGTCGGCGGGCTGACCGGCTACGTCCTTCCCAAGTTTGAGCAGGAG
CGCAGCGAGTTTTACATCTACGATCTGGCGGTCGCGGCGGATGTCCGGCGCCAGGGCATCGCCACCGAACTCATCAGCAC
CATCAAGCGCATCGCCAAGCAGCGCGGCATCTATGTCATCTTCGCCCAGGCCGACGATGGCGATGACTCAGCCGTCGCGT
TGTACACCAAGCTCGGCACCCGGGAAGACGTCATGCACTACGACATTCTTCCCGAACACCAGTCGACGTGA

Protein sequence :
MNAPPSIRLLGASDAPALRQMLGLFSEAFDDPESYLNHQPSDAYLTRLLASDTFIAVAAFAAGQVVGGLTGYVLPKFEQE
RSEFYIYDLAVAADVRRQGIATELISTIKRIAKQRGIYVIFAQADDGDDSAVALYTKLGTREDVMHYDILPEHQST

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aacC1/aacCA1 ACV89836.1 type A aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR7 Protein 2e-33 60
aacC1 AFV53117.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 2e-33 60
aacCA1 AGK36643.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR26 Protein 2e-33 60
aacC1/aacCA1 ACN81021.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR5 Protein 3e-33 60
aacC1 YP_005797146.1 aminoglycoside N(3')-acetyltransferase I Not tested AbaR4e Protein 2e-33 60
aacC1/aacCA1 ACN81020.1 aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR5 Protein 2e-33 60
aac3 CAJ77083.1 Aminoglycoside 3-acetyltransferase Not tested AbaR1 Protein 1e-33 60
aacC1/aacCA1 ACV89833.1 type A aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR7 Protein 1e-33 60
aacC1 AFV53118.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 1e-33 60
acc(3)Ic ACY75521.1 Aac(3) Ic Not tested Tn6060 Protein 2e-36 57
aacCA5 AAR21853.1 aminoglycoside (3) acetyltransferase; AacCA5 or AAC(3)-Ie Not tested SGI1 Protein 6e-31 51
aacCA5 AGF35061.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 6e-31 51
aacCA5 AGK06931.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 6e-31 51
aacCA5 AGK06968.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 6e-31 51
aacCA5 AGK07014.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 6e-31 51
aacCA5 AGK07072.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 6e-31 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyagr_2371 YP_007046818.1 acetyltransferase NC_010410.6002585.p0 Protein 5e-34 60
Cyagr_2371 YP_007046818.1 acetyltransferase NC_011586.7045205.p0 Protein 5e-34 60
Cyagr_2371 YP_007046818.1 acetyltransferase AF318077.1.gene3.p01 Protein 8e-34 59
Cyagr_2371 YP_007046818.1 acetyltransferase U04610.gene.p01 Protein 1e-33 59