Gene Information

Name : BN6_09420 (BN6_09420)
Accession : YP_007035144.1
Strain : Saccharothrix espanaensis DSM 44229
Genome accession: NC_019673
Putative virulence/resistance : Virulence
Product : Two-component system, response regulator of the winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 951368 - 952045 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
GTGTCGACTGCTGCCAGGGTGTTGGTGATCGAAGACGCGGAGGCCATCGGCGCCGCGGTGAGCTCGGCCCTGCGCGATGC
GGGCTACCAGGTCCAGGTCCGTCCGGACGGCCGGGACTTGGAGGGCGAGCTCACCCGGTTCCGGCCCGACCTGGTGGTGC
TGGACGTGATGCTGCCGGGCCGGGACGGGTTCATGCTGCTGGAGGTCATCCGGCGCACCAGCGGGGCGGGCGTGGTCATG
CTGACGGCCCGGGACGGTGTGGTGGACCGGTTGCGCGGGCTCGACCGGGGCGCGGACGACTACGTGGTGAAGCCGTTCGT
GCTGGCCGAACTGGTGGCCAGGGTCAGTGCGGTGCTGCGGAGGCTGGGCCGCACGCCGTCGACCGTGCAGATCGGCGACC
TGGTGGTGGACGCCGACTCGGCCGTGGTGCTGCGCGGGGGCGCCCCCGTGGAGCTGACAGCGACCGAGCTGCGGCTGCTG
CGCTACCTGGCCGCCCAGCGCGGGCGGGTGGTCGGCAAGACGCAGATCCTGACCGCGGTGTGGGGTTACGAGGACTACGA
CCCCAACCTGGTCGAGGTGCACGTCAGCGCGCTGCGACGGAAGCTGGAGGAGCACGGGCCCCGCTTGCTGCACACCGTGC
GGGGGTTGGGGTACGTGTTGCGAGCGGAAGACTCGTGA

Protein sequence :
MSTAARVLVIEDAEAIGAAVSSALRDAGYQVQVRPDGRDLEGELTRFRPDLVVLDVMLPGRDGFMLLEVIRRTSGAGVVM
LTARDGVVDRLRGLDRGADDYVVKPFVLAELVARVSAVLRRLGRTPSTVQIGDLVVDADSAVVLRGGAPVELTATELRLL
RYLAAQRGRVVGKTQILTAVWGYEDYDPNLVEVHVSALRRKLEEHGPRLLHTVRGLGYVLRAEDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-25 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family BAC0083 Protein 6e-26 45
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family BAC0125 Protein 4e-26 43
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family BAC0638 Protein 3e-20 43
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family BAC0197 Protein 9e-27 43
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family AE000516.2.gene3505. Protein 9e-22 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family VFG1389 Protein 6e-27 46
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family VFG1390 Protein 1e-25 44
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family VFG0596 Protein 8e-26 43
BN6_09420 YP_007035144.1 Two-component system, response regulator of the winged helix family VFG1386 Protein 6e-30 43