Gene Information

Name : BN6_76020 (BN6_76020)
Accession : YP_007041700.1
Strain : Saccharothrix espanaensis DSM 44229
Genome accession: NC_019673
Putative virulence/resistance : Virulence
Product : Two-component system, response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8399408 - 8400085 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGAAGGCACGCGTGCTCGTGGTGGACGACGACCCCGCTCTGGCGGAGATGCTGACCATCGTGCTGCGGGGCGAGGGGTT
CGATACCGCGGTGGTGGCCGATGGCGCCCGCGCGCTGCCCGCGCTCCGCGAGTTGAAACCGGACCTGGTGCTGCTCGACC
TCATGCTCCCGGGCATGAACGGCATCGACGTGTGCAAGGCGATCCGCTCCGAGTCGGGCGTCCCGATCGTCATGCTCACC
GCGAAGAGCGACACCGTGGACGTCGTGCTCGGCCTGGAGTCCGGCGCGGACGACTACGTGGTCAAGCCGTTCAAGCCGAA
GGAGCTGGTGGCGCGGATCCGCGCGCGCCTGCGGCGCACCGAGGCCGAGCCCGCCGAGGTGCTCCAGATCGGCGACCTGA
CCATCGACGTGCCCGGCCACGAGGTGCTGCGCGAGGGCAAGCCGATCCAGCTCACCCCGCTGGAGTTCGACCTGCTGGTG
GCACTGGCCCGCAAGCCGCGCCAGGTGTTCACCCGCGAGGTCCTGCTCGAACAGGTGTGGGGCTACCGGCACGCGGCGGA
CACCCGGCTGGTGAACGTCCACGTGCAGCGCCTGCGCTCGAAGGTGGAGCGCGACCCCGAGCACCCCGAGGTGGTGCTGA
CCGTCCGCGGCGTCGGGTACAAGGCGGGCCCTCCGTGA

Protein sequence :
MKARVLVVDDDPALAEMLTIVLRGEGFDTAVVADGARALPALRELKPDLVLLDLMLPGMNGIDVCKAIRSESGVPIVMLT
AKSDTVDVVLGLESGADDYVVKPFKPKELVARIRARLRRTEAEPAEVLQIGDLTIDVPGHEVLREGKPIQLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVERDPEHPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-37 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_76020 YP_007041700.1 Two-component system, response regulator AE000516.2.gene3505. Protein 3e-76 82
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0125 Protein 9e-35 47
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002952.2859905.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002758.1121668.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_007622.3794472.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_009641.5332272.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_013450.8614421.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_007793.3914279.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002745.1124361.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_003923.1003749.p0 Protein 3e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_009782.5559369.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002951.3237708.p0 Protein 4e-42 46
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_012469.1.7685629. Protein 3e-38 45
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_012469.1.7686381. Protein 1e-41 44
BN6_76020 YP_007041700.1 Two-component system, response regulator HE999704.1.gene2815. Protein 3e-39 44
BN6_76020 YP_007041700.1 Two-component system, response regulator AE016830.1.gene1681. Protein 4e-42 43
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_010079.5776364.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002952.2859858.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_007622.3794948.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_003923.1003417.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_013450.8614146.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002951.3238224.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_007793.3914065.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002758.1121390.p0 Protein 1e-35 42
BN6_76020 YP_007041700.1 Two-component system, response regulator CP000647.1.gene4257. Protein 6e-26 42
BN6_76020 YP_007041700.1 Two-component system, response regulator CP001138.1.gene4273. Protein 2e-26 42
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0533 Protein 6e-26 42
BN6_76020 YP_007041700.1 Two-component system, response regulator CP004022.1.gene3215. Protein 6e-27 42
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0197 Protein 2e-30 42
BN6_76020 YP_007041700.1 Two-component system, response regulator CP001918.1.gene5135. Protein 5e-22 42
BN6_76020 YP_007041700.1 Two-component system, response regulator AE015929.1.gene1106. Protein 2e-31 41
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0111 Protein 7e-28 41
BN6_76020 YP_007041700.1 Two-component system, response regulator HE999704.1.gene1528. Protein 8e-31 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP000675.2.gene1535. Protein 9e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP000034.1.gene3834. Protein 3e-26 41
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002695.1.915041.p Protein 3e-26 41
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0308 Protein 1e-28 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP000034.1.gene3671. Protein 7e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0596 Protein 1e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator BAC0039 Protein 1e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP001918.1.gene3444. Protein 8e-35 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP000647.1.gene2531. Protein 4e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP001138.1.gene2239. Protein 1e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator CP000034.1.gene2186. Protein 1e-34 41
BN6_76020 YP_007041700.1 Two-component system, response regulator NC_002695.1.916589.p Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_76020 YP_007041700.1 Two-component system, response regulator VFG1389 Protein 1e-29 45
BN6_76020 YP_007041700.1 Two-component system, response regulator VFG1702 Protein 3e-37 44
BN6_76020 YP_007041700.1 Two-component system, response regulator VFG1390 Protein 8e-33 43
BN6_76020 YP_007041700.1 Two-component system, response regulator VFG1563 Protein 5e-37 43