Gene Information

Name : BN6_74520 (BN6_74520)
Accession : YP_007041552.1
Strain : Saccharothrix espanaensis DSM 44229
Genome accession: NC_019673
Putative virulence/resistance : Resistance
Product : Two-component system, response regulator of the winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8238405 - 8239136 bp
Length : 732 bp
Strand : +
Note : -

DNA sequence :
TTGTCTCCACAGGACGTTCACAACTCTCCCCGTTCGTCTCCACCGGTCGGCCATAGAGTCGTCGGCATGACTCGTCGGGT
TCTGGTGGTCGAGGACGACCTCACCATCGCTTCGTCCGTGGCCGCGCGGTTGCGGGCCGAGGGGTTCGACGTCGACCTGG
CGCACGACGGGCCGTCGGCCGTGGCCAAGGCAGGCAACGCCGACCTGGTCGTGCTGGACGTGATGCTGCCGGGCTTCGAC
GGGCTGGAGGTGTGCCGCCGGATCCAGGCCGAACGGCCGGTGCCGGTGCTGATGCTGACCGCGCGGGGCGACGAGACCGA
CCTGCTGGTGGGGCTGGCGGTCGGCGCGGACGACTACCTGACCAAGCCGTTCTCCATCCGCGAGCTGGCCGCCCGGGTGC
ACGCGCTGCTGCGCCGGGTGGAGCGCTCGGCCGCGCCGCCCACCCGGATCTCGGTGGCCGACGTGGAGATCGACCTGGCC
GAGCGGCGGGTGCTGCGCGCGGGCGAGGAGGCCCACCTCACGCCGACCGAGTTCGAGCTGCTGGTGCACCTGGCCGAGCG
GCCGCGCGCGGTGCAGTCCCGGGAACGGCTGCTCAGCGCGGTCTGGGGGTGGCCGGACGGCACCGGCACGCGGACCGTGG
ACAGCCACATCAAGGCGTTGCGGCGCAAGCTCGGCACGGACCTGATCCGGACCGTGCACGGCGTCGGCTACGCCCTGGAG
GTGCCCCGGTGA

Protein sequence :
MSPQDVHNSPRSSPPVGHRVVGMTRRVLVVEDDLTIASSVAARLRAEGFDVDLAHDGPSAVAKAGNADLVVLDVMLPGFD
GLEVCRRIQAERPVPVLMLTARGDETDLLVGLAVGADDYLTKPFSIRELAARVHALLRRVERSAAPPTRISVADVEIDLA
ERRVLRAGEEAHLTPTEFELLVHLAERPRAVQSRERLLSAVWGWPDGTGTRTVDSHIKALRRKLGTDLIRTVHGVGYALE
VPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-31 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family AE000516.2.gene3505. Protein 1e-40 45
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_002952.2859905.p0 Protein 9e-41 44
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_007622.3794472.p0 Protein 1e-40 44
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_002745.1124361.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_009782.5559369.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_002951.3237708.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_002758.1121668.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_003923.1003749.p0 Protein 8e-41 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_009641.5332272.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_013450.8614421.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_007793.3914279.p0 Protein 1e-40 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family BAC0083 Protein 9e-32 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family BAC0125 Protein 9e-31 42
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family BAC0638 Protein 2e-27 42
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family AF310956.2.orf0.gene Protein 9e-32 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family AE016830.1.gene2255. Protein 5e-32 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family U35369.1.gene1.p01 Protein 5e-32 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family AF162694.1.orf4.gene Protein 1e-32 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_012469.1.7686381. Protein 2e-35 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family NC_012469.1.7685629. Protein 2e-36 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family FJ349556.1.orf0.gene Protein 1e-34 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family BAC0197 Protein 4e-30 41
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family CP001918.1.gene3444. Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family VFG1389 Protein 6e-30 45
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family VFG1390 Protein 2e-35 43
BN6_74520 YP_007041552.1 Two-component system, response regulator of the winged helix family VFG1386 Protein 2e-34 41