Gene Information

Name : resD (BN6_06690)
Accession : YP_007034870.1
Strain : Saccharothrix espanaensis DSM 44229
Genome accession: NC_019673
Putative virulence/resistance : Virulence
Product : Transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 676616 - 677308 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
ATGAACGAGACCGGTCGGGTGCTCGTCGTGGACGACGACGTGACGGTGCGCGATGTCGTGCGCCGCTACCTGGAGCTGGC
CGGGCACCAGGTCGAACTGGTCGGCGACGGCGAGCACGCGCTGCGCCGCGTCGCCGAGCGCGAACCGGACCTGGTCGTGC
TTGACCTCATGCTGCCCGGCATCGACGGTCTGGAGGTGTGCCGCCGGCTGCGGGCGCGCAGCGCGGTGCCGGTGGTGATG
CTGACCGCGCTCGGCGAGGAGGAGGACCGGATCGCCGGGCTCCAGCTCGGCGCGGACGACTACGTGACCAAGCCGTTCAG
CCCGCGCGAGCTGGCCCTGCGGGTGACCTCCGTGCTGCGCCGGTCGCGGGTGGTCGCCGACCGGGGCACGCCGGCGCTCG
TCGACGGCGGCCTGCGGGTCGACGTCGGCGCGCGCTCGGCGTCGTTGGACGGTCGGGAGCTGTCGCTGACCACCCGCGAG
TTCGACCTGCTGGTGTTCTTCCTGACCCACCGGGGCACCGCGTTCGACCGGGCCGAGCTGCTGGCCAGGGTGTGGGGCTG
GGAGTTCGGCGACCAGTCCACGGTGACCGTCCACGTGCGCCGGCTGCGCGAGAAGGTCGAGGTCGACTCGGCCCGCCCGG
TGCGGATCGCGACCGTGTGGGGCGTCGGCTACCGGTACGACGGGGGCGCGTGA

Protein sequence :
MNETGRVLVVDDDVTVRDVVRRYLELAGHQVELVGDGEHALRRVAEREPDLVVLDLMLPGIDGLEVCRRLRARSAVPVVM
LTALGEEEDRIAGLQLGADDYVTKPFSPRELALRVTSVLRRSRVVADRGTPALVDGGLRVDVGARSASLDGRELSLTTRE
FDLLVFFLTHRGTAFDRAELLARVWGWEFGDQSTVTVHVRRLREKVEVDSARPVRIATVWGVGYRYDGGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007034870.1 Transcriptional regulator NC_012469.1.7685629. Protein 2e-32 46
resD YP_007034870.1 Transcriptional regulator AE000516.2.gene3505. Protein 2e-33 46
resD YP_007034870.1 Transcriptional regulator HE999704.1.gene2815. Protein 3e-35 43
resD YP_007034870.1 Transcriptional regulator NC_010410.6002989.p0 Protein 7e-33 42
resD YP_007034870.1 Transcriptional regulator NC_010400.5986590.p0 Protein 6e-33 42
resD YP_007034870.1 Transcriptional regulator NC_011595.7057856.p0 Protein 7e-33 42
resD YP_007034870.1 Transcriptional regulator NC_012469.1.7686381. Protein 4e-33 41
resD YP_007034870.1 Transcriptional regulator NC_002952.2859905.p0 Protein 5e-34 41
resD YP_007034870.1 Transcriptional regulator NC_009641.5332272.p0 Protein 8e-34 41
resD YP_007034870.1 Transcriptional regulator NC_013450.8614421.p0 Protein 8e-34 41
resD YP_007034870.1 Transcriptional regulator NC_007793.3914279.p0 Protein 8e-34 41
resD YP_007034870.1 Transcriptional regulator NC_007622.3794472.p0 Protein 5e-34 41
resD YP_007034870.1 Transcriptional regulator NC_002745.1124361.p0 Protein 8e-34 41
resD YP_007034870.1 Transcriptional regulator NC_009782.5559369.p0 Protein 8e-34 41
resD YP_007034870.1 Transcriptional regulator NC_002951.3237708.p0 Protein 8e-34 41
resD YP_007034870.1 Transcriptional regulator NC_003923.1003749.p0 Protein 6e-34 41
resD YP_007034870.1 Transcriptional regulator NC_002758.1121668.p0 Protein 8e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007034870.1 Transcriptional regulator VFG1702 Protein 2e-30 41
resD YP_007034870.1 Transcriptional regulator VFG1389 Protein 2e-27 41