Gene Information

Name : BN6_04170 (BN6_04170)
Accession : YP_007034621.1
Strain : Saccharothrix espanaensis DSM 44229
Genome accession: NC_019673
Putative virulence/resistance : Virulence
Product : Two-component system, response regulator of the winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 423749 - 424465 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
TTGCCGCACCATGAGCACGTGGACAAGGCCAATGCGGTTCGACTGCTCGTCGTGGACGACGAACCCCACATCGCGGACCT
GGTGGCCACGGTCGCCCGGTACGAGGGGTGGCAGGCGGCCACCGCGGCCAGCGGCGAGGCCGCGCTCGCGACCGCGGCCG
AGTTCCACCCGGACATCGTGGTGCTCGACCTGATGCTGCCCGACCTGGACGGGTTCACCGTGCTGGACCGGCTGCGCTCG
TCCGGCGCGATGGTGCCGGTGGTGTTCCTGACCGCCCGCGACGGCACCGCGGACCGGGTGGCCGGGCTGACCCGGGGCGG
CGACGACTACCTGGTCAAGCCGTTCTCGGTGGAGGAGCTGATGGCCCGGCTGCGGGCCGTGCTGCGGCGCTCCACCGGGC
CGCAGTGGAAGCGGTCGGTGCTGAAGGTGTCGGACCTGGCGATGGACGAGGACACCCGCGAGGTGCGCCGCGCGGGCCGG
CTGGTCACCCTCACGCCCACCGAGTACGAGCTGCTGCGCTACCTGATGCGCCGCTCGCCCGCCGTGCTGACCAAGGCGCA
GATCCTCGACCACGTGTGGGAGTACGACTTCGGCGGCCGGTCCAACGTCGTGGAGCTGGTCATCTCGCACCTGCGGCGCA
AGCTGGACGACGGCCACCAGCCGCTGATCCACACCGTGCGCGGCGTCGGCTACGTGCTGCGCAAGGCCCCGGACTAG

Protein sequence :
MPHHEHVDKANAVRLLVVDDEPHIADLVATVARYEGWQAATAASGEAALATAAEFHPDIVVLDLMLPDLDGFTVLDRLRS
SGAMVPVVFLTARDGTADRVAGLTRGGDDYLVKPFSVEELMARLRAVLRRSTGPQWKRSVLKVSDLAMDEDTREVRRAGR
LVTLTPTEYELLRYLMRRSPAVLTKAQILDHVWEYDFGGRSNVVELVISHLRRKLDDGHQPLIHTVRGVGYVLRKAPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0197 Protein 9e-39 50
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0638 Protein 5e-31 48
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0125 Protein 3e-35 46
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0308 Protein 1e-33 46
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0083 Protein 1e-38 44
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family AE015929.1.gene1106. Protein 7e-28 44
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family HE999704.1.gene1528. Protein 8e-28 44
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0347 Protein 1e-29 44
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_002952.2859858.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_007622.3794948.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_003923.1003417.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_013450.8614146.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_002951.3238224.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_007793.3914065.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_002758.1121390.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_010079.5776364.p0 Protein 1e-31 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family BAC0111 Protein 5e-33 42
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family NC_002516.2.879194.p Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family VFG1386 Protein 3e-52 52
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family VFG1389 Protein 3e-37 48
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family VFG1390 Protein 3e-41 46
BN6_04170 YP_007034621.1 Two-component system, response regulator of the winged helix family VFG0596 Protein 7e-31 43