Gene Information

Name : BN6_38910 (BN6_38910)
Accession : YP_007038053.1
Strain : Saccharothrix espanaensis DSM 44229
Genome accession: NC_019673
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4245888 - 4246571 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence : 
ATGGCGGACGTGCGGGTGCTGGTGGTCGAGGACGAGCGGCGGCTGGCCGAGACGCTCCAGTGGGGGTTGGAGGCGGACGG
TTACGCCGTGGACCTCGCGCACGACGGCGGCGAGGGCCTGCGGCTGGCCCAGGAGCACCCGTACCAGGCGATCGTGCTGG
ACATCATGCTCCCGGTGCTCAACGGCTACCGGGTGTGCGCGGAGCTGCGCCGGCTCGGCGTGACCACGCCGATCCTCATG
CTCACCGCCAAGAACGGCGAGTACGACGAGGTCGAGGCGCTGGACACCGGGGCCGACGACTTCCTGCGCAAGCCCTTCTC
CTACCCGGTGCTCACCGCGCGGCTGCGGGCGCTGCTGCGGCGCGGGGCGGCCGGGCGCGAGCCGGTCATCACGGTCGGGG
ACCTGGTGGTCGACCCGGGCCGGCGGACCTGCCGGCGGGCCGGCGAGCCGATCGCGTTGACCGCCAAGGAGTTCGCGGTG
CTGGAGTGCCTCGCGCGGCACGCCGGGCAGGTGGTGTCCAAAACGGACATCCTCGACCAGGTCTGGGACATGGCCTACCA
GGGCGACCCGAACATCGTGGAGGTCTACGTGAGCGCGTTGCGCCGCAAGGTGGACGCGCCGTTCGGCCGCCGCACGATCG
GCACCGTGCGCGGCGTGGGCTACCGGCTGGTCGCCGATGCCTAG

Protein sequence : 
MADVRVLVVEDERRLAETLQWGLEADGYAVDLAHDGGEGLRLAQEHPYQAIVLDIMLPVLNGYRVCAELRRLGVTTPILM
LTAKNGEYDEVEALDTGADDFLRKPFSYPVLTARLRALLRRGAAGREPVITVGDLVVDPGRRTCRRAGEPIALTAKEFAV
LECLARHAGQVVSKTDILDQVWDMAYQGDPNIVEVYVSALRRKVDAPFGRRTIGTVRGVGYRLVADA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_38910 YP_007038053.1 putative two-component system response regulator BAC0308 Protein 3e-31 44
BN6_38910 YP_007038053.1 putative two-component system response regulator BAC0111 Protein 1e-29 43
BN6_38910 YP_007038053.1 putative two-component system response regulator BAC0125 Protein 4e-29 42
BN6_38910 YP_007038053.1 putative two-component system response regulator BAC0083 Protein 1e-29 42
BN6_38910 YP_007038053.1 putative two-component system response regulator BAC0197 Protein 3e-29 42
BN6_38910 YP_007038053.1 putative two-component system response regulator BAC0638 Protein 1e-22 41
BN6_38910 YP_007038053.1 putative two-component system response regulator NC_002516.2.879194.p Protein 3e-20 41
BN6_38910 YP_007038053.1 putative two-component system response regulator U82965.2.orf14.gene. Protein 7e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN6_38910 YP_007038053.1 putative two-component system response regulator VFG0596 Protein 8e-29 43
BN6_38910 YP_007038053.1 putative two-component system response regulator VFG1390 Protein 2e-29 43
BN6_38910 YP_007038053.1 putative two-component system response regulator VFG1389 Protein 6e-28 42