Gene Information

Name : PputUW4_00417 (PputUW4_00417)
Accession : YP_007027430.1
Strain : Pseudomonas sp. UW4
Genome accession: NC_019670
Putative virulence/resistance : Resistance
Product : Quaternary ammonium compound-resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 480058 - 480390 bp
Length : 333 bp
Strand : -
Note : [P] COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGACCGCTTACTACTACCTGGCCATTGCCATCTGCGCCGAAGTGATTGCCACTGTTTCGATGAAAGCGGTCAAAGGCTT
CAGCACCCCGCTGCCACTGGTGCTGGTCATCGTCGGCTACGGCATTGCCTTCTGGATGCTGACCCTGGTGGTGCGCAGCG
TTCCCGTGGGTGTGGCGTATGCCGTGTGGGCCGGCATGGGGATCGTGATGGTCAGCGTCGCGGCGCTGTTTATCTACGGG
CAGAAACTGGACGTGCCGGCGATGCTGGGGATGGCGTTGATTGTGCTGGGGGTTGTGGTCATCCAGCTCTTCTCCAAAAC
TGCAGGGCATTAG

Protein sequence :
MTAYYYLAIAICAEVIATVSMKAVKGFSTPLPLVLVIVGYGIAFWMLTLVVRSVPVGVAYAVWAGMGIVMVSVAALFIYG
QKLDVPAMLGMALIVLGVVVIQLFSKTAGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-17 51
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 51
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-17 51
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 51
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-17 51
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 51
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-17 51
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 51
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-17 51
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-17 51
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-17 51
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-17 51
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-17 51
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-17 51
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-17 51
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-17 51
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-17 51
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-17 51
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-17 51
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-17 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0377 Protein 3e-27 59
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein CP004022.1.gene1549. Protein 2e-24 54
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0322 Protein 5e-22 52
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0324 Protein 9e-21 51
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein CP001138.1.gene1489. Protein 3e-21 51
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0323 Protein 6e-18 51
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0002 Protein 1e-21 47
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein NC_010410.6003348.p0 Protein 1e-21 47
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein NC_002695.1.913273.p Protein 3e-18 46
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0150 Protein 3e-18 45
PputUW4_00417 YP_007027430.1 Quaternary ammonium compound-resistance protein BAC0192 Protein 6e-14 42