Gene Information

Name : spaP (PputUW4_03628)
Accession : YP_007030625.1
Strain : Pseudomonas sp. UW4
Genome accession: NC_019670
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4214266 - 4214925 bp
Length : 660 bp
Strand : -
Note : [U] COG4790 Type III secretory pathway, component EscR

DNA sequence :
ATGAACGACGTTTCGCTGATCGCGCTGCTGGCGTTCGCTTCACTGCTGCCGTTTCTGGTGGCGGCCGGCACCTGCTACAT
CAAGTTTTCCATCGTCTTTGTCATCGTGCGTAATGCCTTGGGCTTGCAGCAGGTGCCCTCGAACATGGCCCTCAATGCAA
TCGCCTTGATGCTGGCGATTTTCGTGATGACGCCGGTGATGAAACAGGGCTATGGCTATTACAAGGAAGAACAGGTGGCT
TTTACCGACATCGAGTCGGTGGTGAATTTCGCCGAGAACGGGTTGGGCGGCTACAAGGACTACCTGCGCAAGTACACCGA
CCCGGAACTGGCTCTGTTCTTCGAGCGGGCGCAAGCGGTGCAGAGTGAGTCCGACATCGTTCTGCCCGCCGATGAAGAAC
TCACGCCGTCGCTGTTTTCGCTGCTGCCGGCCTACGCATTGAGTGAAATCAAAAGCGCCTTCAAGATCGGCTTCTACCTG
TACTTACCCTTTGTGATCGTCGACCTGGTGATCTCCAGCATCCTGCTGGCGCTGGGCATGATGATGATGAGCCCGGTGAT
CATTTCGGTGCCGATCAAATTGGTATTGTTTGTTGCTCTGGACGGCTGGGCGCTGCTGTCCACCGGGCTGGTCAAGCAAT
ACCTGACGTTGCTGGCATAG

Protein sequence :
MNDVSLIALLAFASLLPFLVAAGTCYIKFSIVFVIVRNALGLQQVPSNMALNAIALMLAIFVMTPVMKQGYGYYKEEQVA
FTDIESVVNFAENGLGGYKDYLRKYTDPELALFFERAQAVQSESDIVLPADEELTPSLFSLLPAYALSEIKSAFKIGFYL
YLPFVIVDLVISSILLALGMMMMSPVIISVPIKLVLFVALDGWALLSTGLVKQYLTLLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 4e-55 67
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 9e-54 66
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 2e-51 65
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 1e-51 65
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 1e-51 65
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 2e-51 65
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 1e-55 63
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 5e-48 56
escR AAK26700.1 EscR Virulence LEE Protein 4e-34 47
escR AAL57527.1 EscR Virulence LEE Protein 4e-34 47
escR CAC81847.1 EscR protein Virulence LEE II Protein 4e-34 47
escR CAI43889.1 EscR protein Virulence LEE Protein 4e-34 47
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 6e-34 47
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 6e-34 47
lscR AAO18040.1 LscR Virulence TTSS locus Protein 5e-36 46
escR AAC31528.1 L0049 Virulence LEE Protein 5e-34 46
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 5e-34 46
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 7e-34 46
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 7e-34 46
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 7e-34 46
escR AAC38369.1 EscR Virulence LEE Protein 2e-33 46
unnamed AAL06354.1 EscR Virulence LEE Protein 8e-31 45
YPO0270 YP_002345352.1 type III secretion system protein Virulence Not named Protein 1e-29 44
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-30 44
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-30 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaP YP_007030625.1 surface presentation of antigens protein VFG1012 Protein 2e-55 66
spaP YP_007030625.1 surface presentation of antigens protein VFG0551 Protein 6e-52 65
spaP YP_007030625.1 surface presentation of antigens protein VFG1773 Protein 2e-55 63
spaP YP_007030625.1 surface presentation of antigens protein VFG2455 Protein 6e-54 62
spaP YP_007030625.1 surface presentation of antigens protein VFG0715 Protein 1e-33 46
spaP YP_007030625.1 surface presentation of antigens protein VFG0827 Protein 2e-34 46
spaP YP_007030625.1 surface presentation of antigens protein VFG0188 Protein 3e-34 45
spaP YP_007030625.1 surface presentation of antigens protein VFG0394 Protein 5e-35 45
spaP YP_007030625.1 surface presentation of antigens protein VFG0044 Protein 7e-28 42
spaP YP_007030625.1 surface presentation of antigens protein VFG1259 Protein 1e-24 42