Gene Information

Name : spaQ (PputUW4_03627)
Accession : YP_007030624.1
Strain : Pseudomonas sp. UW4
Genome accession: NC_019670
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4214001 - 4214255 bp
Length : 255 bp
Strand : -
Note : [U] COG4794 Type III secretory pathway, component EscS

DNA sequence :
ATGAACGATCTGGTCTATGCCGGCAATAAAACCCTGTACCTGATCCTGTTGATGGTGGCGTGGCCAATCATCGTTGCCAC
GGTGGTCGGCCTGGTGGTCGGTCTGATTCAGACCGTGACCCAGTTACAGGAGCAGACCCTGCCGTTCGGTTTCAAACTGC
TGGCCGTCGCCGCGTGCCTGTTTTTGCTGTCGGGCTGGTACGGCGAAACCTTGCTCGATTTCAGTCGAGAAGTCATCCGC
CTGGCGCTGGCTTAG

Protein sequence :
MNDLVYAGNKTLYLILLMVAWPIIVATVVGLVVGLIQTVTQLQEQTLPFGFKLLAVAACLFLLSGWYGETLLDFSREVIR
LALA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaQ AAS66866.1 SpaQ Not tested SSR-2 Protein 3e-26 77
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 1e-25 73
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 1e-25 73
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 1e-25 73
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 1e-25 73
epaQ AAZ31292.1 EpaQ Virulence ETT2 Protein 6e-22 70
ECs3724 NP_311751.1 EpaQ Not tested LIM Protein 1e-21 68
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 1e-15 58
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 2e-10 44
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 6e-09 44
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 6e-09 44
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 6e-09 44
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 1e-08 41
hrcS ABQ88360.1 HrcS Virulence Hrp PAI Protein 2e-05 41
hrpO AAB05076.1 HrpO Virulence Hrp PAI Protein 2e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaQ YP_007030624.1 surface presentation of antigens protein VFG0550 Protein 4e-26 73
spaQ YP_007030624.1 surface presentation of antigens protein VFG1013 Protein 1e-21 65
spaQ YP_007030624.1 surface presentation of antigens protein VFG2454 Protein 4e-17 60
spaQ YP_007030624.1 surface presentation of antigens protein VFG1772 Protein 1e-20 58
spaQ YP_007030624.1 surface presentation of antigens protein VFG0187 Protein 0.001 45
spaQ YP_007030624.1 surface presentation of antigens protein VFG0043 Protein 4e-07 42
spaQ YP_007030624.1 surface presentation of antigens protein VFG0395 Protein 9e-10 42