Gene Information

Name : PputUW4_02690 (PputUW4_02690)
Accession : YP_007029690.1
Strain : Pseudomonas sp. UW4
Genome accession: NC_019670
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3147626 - 3148288 bp
Length : 663 bp
Strand : -
Note : [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
GTGCGTTTATTACTCGTAGAGGATGACGTGGCGCTCGGCGAGGGCATTCATCAGGCCCTGCGCCGTGAAGGTTATACCGT
CGACTGGTTGCAGGACGGCAACAGTGCCTTGCACTCGCTGCTCAGTGAAATCTTTGATCTGGCGGTGCTCGACCTTGGCC
TGCCACGCATGGACGGTCTCGAAGTGCTCAGGCGCTTGCGTGACAGCGGCTCCAACCTGCCGGTGCTGATCCTGACGGCA
CGCGATGCCACCGAAGACCGCATCGCCGGTCTGGATGTCGGCGCCGATGACTACCTGATCAAGCCCTTCGACCTGGCAGA
GTTGAAGGCGCGCATACGTGCGTTGCTTCGGCGCAGCGCCGGGCGTGGGCAATCGCTGATCGAGCACGCGGGCATCAGCC
TCAACCCCGGTACCCAGCAAGTCAGCTACAAGGGCGAACCGGTGGCCCTGACACCCAAGGAATACCAGTTGCTCCACGAA
CTGCTCTCGCCACCGGGCCGGGTAATGACTCGCGATCATCTGATGCAGTTGCTGTACGGCTGGAGCGAGGAGGCCGAAAG
CAACACGCTGGAAGTGCACATCCATCACCTGCGCAAGAAGCTCTCCACCGATCTGATTCGCACCGTCCGTGGTATCGGTT
ATCTGGTGGAGGAGCGTCGATGA

Protein sequence : 
MRLLLVEDDVALGEGIHQALRREGYTVDWLQDGNSALHSLLSEIFDLAVLDLGLPRMDGLEVLRRLRDSGSNLPVLILTA
RDATEDRIAGLDVGADDYLIKPFDLAELKARIRALLRRSAGRGQSLIEHAGISLNPGTQQVSYKGEPVALTPKEYQLLHE
LLSPPGRVMTRDHLMQLLYGWSEEAESNTLEVHIHHLRKKLSTDLIRTVRGIGYLVEERR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-41 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputUW4_02690 YP_007029690.1 two component transcriptional regulator BAC0487 Protein 4e-43 50
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_002516.2.879194.p Protein 2e-36 44
PputUW4_02690 YP_007029690.1 two component transcriptional regulator BAC0638 Protein 5e-33 42
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-32 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-27 41
PputUW4_02690 YP_007029690.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputUW4_02690 YP_007029690.1 two component transcriptional regulator VFG0473 Protein 3e-46 52
PputUW4_02690 YP_007029690.1 two component transcriptional regulator VFG1390 Protein 5e-39 44
PputUW4_02690 YP_007029690.1 two component transcriptional regulator VFG0596 Protein 6e-33 43