Gene Information

Name : ANA_C12359 (ANA_C12359)
Accession : YP_006996903.1
Strain :
Genome accession: NC_019427
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2648293 - 2648979 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGCGGTTATTATTAGTTGAAGATGAACATGATTTAGGAACTAGTATTCATCATGCTCTTACCCAGCGTGATTATATAGT
AGATTGGGTTGAAGATGGACAAACGGCTTGGGATTATCTGAATACAGTACCACAAAGGTATGAAATTGCAATTTTAGATT
GGATGTTACCCAAGTTATCAGGATTGGAATTATGTCAAAGATTAAGAGGGCAAAAAAATCAATTACCAATTATGCTATTA
ACAGCTAGAGATAGCATGAATGATCGGGTTACGGGTTTAGATGCGGGTGCTGATGATTATCTTGTTAAACCTTTTGGGAT
GGCAGAATTATTGGCACGGGTAAGGGCATTACAAAGAAGATTACCAAATTTCCAACCACCGCAATTACAAATAGGTTCAT
TAATGTTAGATTATAGTAATTTTTCAGTTGTGAATTTAGGATTAGAACCTTCTTTACCAATTATCCTTACAGCCAAAGAA
TTTCAACTACTAGAATATTTAATGCAGCATCCTCAACAAATCCTAACTCATGAACAAATTCGCGCTAGATTGTGGGATTT
TGAAAGTGATACAGTGAGTAATGTTGTGGCTGCACAAGTGAGATTACTAAGACGCAAATTATTAGAATGTGGTTTTCCTA
AAGCTATTGAAACTATGCGAGGTTTTGGTTATCGTTTTTGTGGATAA

Protein sequence :
MRLLLVEDEHDLGTSIHHALTQRDYIVDWVEDGQTAWDYLNTVPQRYEIAILDWMLPKLSGLELCQRLRGQKNQLPIMLL
TARDSMNDRVTGLDAGADDYLVKPFGMAELLARVRALQRRLPNFQPPQLQIGSLMLDYSNFSVVNLGLEPSLPIILTAKE
FQLLEYLMQHPQQILTHEQIRARLWDFESDTVSNVVAAQVRLLRRKLLECGFPKAIETMRGFGYRFCG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-22 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANA_C12359 YP_006996903.1 two-component response regulator BAC0288 Protein 2e-49 55
ANA_C12359 YP_006996903.1 two-component response regulator NC_002516.2.879194.p Protein 3e-28 42
ANA_C12359 YP_006996903.1 two-component response regulator BAC0083 Protein 3e-27 42
ANA_C12359 YP_006996903.1 two-component response regulator BAC0197 Protein 9e-28 42
ANA_C12359 YP_006996903.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-29 41
ANA_C12359 YP_006996903.1 two-component response regulator AE015929.1.gene1106. Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANA_C12359 YP_006996903.1 two-component response regulator VFG1390 Protein 7e-30 42
ANA_C12359 YP_006996903.1 two-component response regulator VFG0596 Protein 2e-22 41