Gene Information

Name : ANA_C11845 (ANA_C11845)
Accession : YP_006996415.1
Strain :
Genome accession: NC_019427
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2043091 - 2043819 bp
Length : 729 bp
Strand : +
Note : -

DNA sequence :
TTGGAAAGTCATAAAGAAAAAATCCTGGTAGTAGACGACGAAGCCAGCATTCGGCGGATTTTGGAAACACGCCTTTCCAT
GATTGGCTACGATGTAGTGACAGCAGGAGATGGTGAGGAAGCTTTAGAAATATTTCGCAAAGCTGAACCAGACCTAGTAG
TTTTAGACGTAATGATGCCAAAACTAGATGGTTATGGCGTTTGTCAAGAATTACGCAAAGAATCCGATGTCCCCATTATT
ATGCTCACCGCTTTGGGAGATGTGGCAGATCGCATCACCGGCTTAGAATTGGGTGCGGATGATTATGTCGTTAAACCCTT
TTCACCCAAAGAACTAGAAGCACGGATTCGTTCAGTCTTGCGACGGGTGGACAAAACAGGTGCAAATGGTATTCCTAGTT
CTGGGGTGATTCATGTCAGCACCATCAAAATTGATACAAATAAGCGTCAAGTTTATAAGGGTGATGAGCGCATTCGCTTA
ACCGGTATGGAATTTAGCTTATTAGAATTGTTAGTCAGTCGTTCTGGTGAAGCTTTTTCCCGCTCAGAAATTTTGCAGGA
AGTATGGGGATATACTCCTGAACGCCATGTAGATACTCGCGTTGTGGATGTACATATCTCTCGTTTACGGGCAAAATTAG
AAGATGATCCCAGCAACCCTGAACTAATTCTCACCGCTAGAGGTACTGGTTATCTGTTCCAACGCATATTAGAACCAGGG
GAAGAGTAA

Protein sequence :
MESHKEKILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALEIFRKAEPDLVVLDVMMPKLDGYGVCQELRKESDVPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVDKTGANGIPSSGVIHVSTIKIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEAFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRILEPG
EE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANA_C11845 YP_006996415.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_007622.3794472.p0 Protein 9e-47 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-46 49
ANA_C11845 YP_006996415.1 two-component response regulator NC_012469.1.7685629. Protein 1e-42 46
ANA_C11845 YP_006996415.1 two-component response regulator AE000516.2.gene3505. Protein 7e-44 45
ANA_C11845 YP_006996415.1 two-component response regulator HE999704.1.gene2815. Protein 1e-41 45
ANA_C11845 YP_006996415.1 two-component response regulator BAC0125 Protein 3e-39 44
ANA_C11845 YP_006996415.1 two-component response regulator BAC0083 Protein 1e-35 42
ANA_C11845 YP_006996415.1 two-component response regulator CP001918.1.gene5135. Protein 1e-25 42
ANA_C11845 YP_006996415.1 two-component response regulator BAC0197 Protein 9e-34 42
ANA_C11845 YP_006996415.1 two-component response regulator BAC0638 Protein 3e-28 42
ANA_C11845 YP_006996415.1 two-component response regulator CP000034.1.gene3671. Protein 1e-38 42
ANA_C11845 YP_006996415.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-35 41
ANA_C11845 YP_006996415.1 two-component response regulator CP000675.2.gene1535. Protein 1e-37 41
ANA_C11845 YP_006996415.1 two-component response regulator DQ212986.1.gene4.p01 Protein 4e-32 41
ANA_C11845 YP_006996415.1 two-component response regulator CP004022.1.gene3215. Protein 1e-34 41
ANA_C11845 YP_006996415.1 two-component response regulator CP000034.1.gene3834. Protein 1e-28 41
ANA_C11845 YP_006996415.1 two-component response regulator CP001138.1.gene4273. Protein 7e-29 41
ANA_C11845 YP_006996415.1 two-component response regulator BAC0533 Protein 2e-29 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_002695.1.915041.p Protein 1e-28 41
ANA_C11845 YP_006996415.1 two-component response regulator CP000647.1.gene4257. Protein 2e-29 41
ANA_C11845 YP_006996415.1 two-component response regulator NC_012469.1.7686381. Protein 1e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANA_C11845 YP_006996415.1 two-component response regulator VFG1390 Protein 5e-40 44
ANA_C11845 YP_006996415.1 two-component response regulator VFG1389 Protein 2e-32 43
ANA_C11845 YP_006996415.1 two-component response regulator VFG0596 Protein 3e-31 42