Gene Information

Name : yceC (BN424_3537)
Accession : YP_006994271.2
Strain : Carnobacterium maltaromaticum LMA28
Genome accession: NC_019425
Putative virulence/resistance : Resistance
Product : stress response protein SCP2
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3522042 - 3522644 bp
Length : 603 bp
Strand : -
Note : [T] COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAATTAACTTATCAAAAGGACAAAAAATTGACTTAACTAAATCGAATCCTACATTAAATAATATTACTGTTGGGTT
AGGTTGGGATGAAGCGGCACAATCAGGTGGCGGTGGATTACTAGGTGGTCTTTTCGGATCAAAACCTGCAGCAATTGATT
GCGATGCATCGGTTATTTTACTACAAGGGGATCGTTTTGTAGATAAAAAAGATGTTGTTTACTTTGGACATCTAAAAAGC
GAAGATGGTTCAATCGCACATCAAGGAGACAATTTAACTGGTGAAGGCGATGGAGATGATGAAGTTGTAAAAGTATCATT
GAATAAAGTCAGCCCTAAATACAATAAAATCGTATTCGTAGTAAATATTTATCAAGCTCAAAAACGTAAGCAAGACTTCG
GCATGATTAAAAATGCTTTTATTCGCATCATGGATGATTCAGGAGTTGAAATTGCCCGTTATAACTTAACTGATAACTAC
CAAGGACTAACTGGTTTAGTTGCAGGGGAGCTTTATCGACATGAAGGCGAATGGAAATTTGCGGCAGTTGGTAGTGGGAT
GAATGTTGCTAGTCTTTCTGAAATGTTACAAACATATAAATAA

Protein sequence :
MAINLSKGQKIDLTKSNPTLNNITVGLGWDEAAQSGGGGLLGGLFGSKPAAIDCDASVILLQGDRFVDKKDVVYFGHLKS
EDGSIAHQGDNLTGEGDGDDEVVKVSLNKVSPKYNKIVFVVNIYQAQKRKQDFGMIKNAFIRIMDDSGVEIARYNLTDNY
QGLTGLVAGELYRHEGEWKFAAVGSGMNVASLSEMLQTYK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-35 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-35 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-35 45
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-35 45
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-35 45
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-35 44
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-34 41
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceC YP_006994271.2 stress response protein SCP2 BAC0390 Protein 2e-35 45
yceC YP_006994271.2 stress response protein SCP2 BAC0389 Protein 5e-35 45