Gene Information

Name : tnp1519R (BN424_3532)
Accession : YP_006994266.2
Strain : Carnobacterium maltaromaticum LMA28
Genome accession: NC_019425
Putative virulence/resistance : Unknown
Product : integrase core domain protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3516667 - 3517365 bp
Length : 699 bp
Strand : +
Note : [L] COG3316 Transposase and inactivated derivatives

DNA sequence :
ATGAAAAAACACTTCAAAGGAAAACAGTACGATTACCGAATCATTATAGAAGCCATCGGCTTATATTACCATTTTTCTTT
GAGTTATCGTGATTGTGCAAAAATTATGCGTAAATTCAGTATTGGCGTGGATCACACCACTATTTACCGCTGGAATAAAC
AATACGGGAAAGTTCTTTATCATTTATGGAAGAAACGAAACAAACGAAGAACGCTATCTAAATCCTGGCGGATTGATGAA
ACGTATCTGAAAGTAAAAGGAAAAGATCGTTACCTATATCGAGCCATTGATTCTAACGGGAATACCCTAGATATGTGGCT
GCGAAATCATAGAGATACCGTCTCCACAAAAGCCTTTATGAAGCGATTAATCCATGATTATGGGCAGCCACGTTCGATTG
TGACAGATAAATATGCCCCCTCATTAAAAGCTATTAAAGAGCTGAAAGAAGCAGGCATTCTGGGTCAACACGTGAATCAC
TGGAAGTCCAAATATCTCAATAATATCTTAGAACAAGATCACCGACAGGTGAAAGGGAAACTCACTTCCGTGAAGAATTT
CCAATCTACCTACACAGCAGCTACAACAATTAAAGGTATTGAAGTGGTATCTGCTTTATACAAAGAGAGTCGAAGAGAAA
TTACGCTTTTCGACTTTTCCCCATGGGATGAAATTGAAAGTCTATTCAGAGCGACATGA

Protein sequence :
MKKHFKGKQYDYRIIIEAIGLYYHFSLSYRDCAKIMRKFSIGVDHTTIYRWNKQYGKVLYHLWKKRNKRRTLSKSWRIDE
TYLKVKGKDRYLYRAIDSNGNTLDMWLRNHRDTVSTKAFMKRLIHDYGQPRSIVTDKYAPSLKAIKELKEAGILGQHVNH
WKSKYLNNILEQDHRQVKGKLTSVKNFQSTYTAATTIKGIEVVSALYKESRREITLFDFSPWDEIESLFRAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 5e-44 51
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 5e-41 47
ef0039 AAM75245.1 EF0039 Not tested Not named Protein 3e-37 47
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 4e-41 46
tnp YP_251940.1 transposase for IS431mec Not tested SCCmec Protein 2e-40 46
unnamed BAD24828.1 transposase for IS431 Not tested Type-V SCCmec Protein 4e-40 45
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 3e-41 45
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 5e-41 45
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 5e-41 45
SERP1579 YP_189144.1 IS431mec-like transposase Not tested ¥ÕSP¥â Protein 1e-40 45
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 3e-41 45
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 5e-41 45
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 8e-41 45
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-41 45
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 5e-41 45
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 8e-41 45
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 3e-41 45
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 2e-40 45
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 5e-41 45
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 5e-41 45
tnp YP_254240.1 transposase for IS431mec Not tested ¥ðSh1 Protein 3e-40 45
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 3e-41 45
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 2e-40 45
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 5e-41 45
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 5e-41 45
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 3e-40 45
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 3e-41 45
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 1e-40 45
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 5e-41 45
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 5e-41 45
SE0071 NP_763626.1 transposase for IS-like element Not tested SCCpbp4 Protein 2e-40 45
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-41 45
unnamed AAP55235.1 transposase Not tested SaPIbov2 Protein 6e-41 45
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 5e-41 45
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 5e-41 45
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-41 45
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 5e-41 45
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 5e-41 45
SE0079 NP_763634.1 transposase for IS-like element Not tested SCCpbp4 Protein 1e-40 45