Gene Information

Name : PACID_20270 (PACID_20270)
Accession : YP_006981176.1
Strain : Propionibacterium acidipropionici ATCC 4875
Genome accession: NC_019395
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2162115 - 2162837 bp
Length : 723 bp
Strand : -
Note : -

DNA sequence :
GTGTCCCAGCCCGGAACTGAATCGTCCGGCCAGCGGATTCTCGTCGTCGATGACGATCCTGCCCTGGCAGAGATGCTCCA
GCTGGTGCTGCGCAAGGAACGGTTCATCACGGAGTGGTGCTCGAGCGGCACGGCCGCACTTCCCGCGTTCGAGAAGTTCA
GGCCCGACCTGATCCTGCTGGACCTCATGCTCCCCGGTCTCAGCGGCATCGAGGTGTGCCGCGAGATCAGGCGGGTCTCC
GGCACGCCGATCATCATGCTGACCGCCCGCTCCGACACCCATGACGTGGTCGCCGGCCTCGAGGCGGGAGCCGACGACTA
CGTGTCCAAGCCGTTCAAGTCAAAGGAGCTGGTGGCCCGGATCCGGGCCAGGCTGCGTCAGCCCCTGGATGCCGCACCCG
AGGCCGACCTCATGACCGTCGGCGACATCACCGTCGACGTGCGGGCCCACCAGGTGACACGCGACGGCGAGGAGATCTCG
CTGACCCCGCTGGAGTTCGATCTGCTGGTCGCCCTGGCGCGCCGGCCCCACGAGGTGTTCAGCCGCGACCTGCTCCTCCA
GGAGGTGTGGGGGTACCGCCACGCCGCCGACAACAGACTGGTCAACGTCCACGTGCAGAGGCTCCGCTCGAAGATCGAGC
GGGATCCCGAGCATCCGAGCATCGTCATCACCGTCCGAGGAGTCGGCTACCGGGCCGGCGACGGCGGCGAGGAGGACCGC
TGA

Protein sequence :
MSQPGTESSGQRILVVDDDPALAEMLQLVLRKERFITEWCSSGTAALPAFEKFRPDLILLDLMLPGLSGIEVCREIRRVS
GTPIIMLTARSDTHDVVAGLEAGADDYVSKPFKSKELVARIRARLRQPLDAAPEADLMTVGDITVDVRAHQVTRDGEEIS
LTPLEFDLLVALARRPHEVFSRDLLLQEVWGYRHAADNRLVNVHVQRLRSKIERDPEHPSIVITVRGVGYRAGDGGEEDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-30 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-58 66
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-32 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-25 44
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 8e-26 43
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-33 43
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 7e-28 43
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-30 42
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family BAC0308 Protein 4e-23 42
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-21 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-31 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 1e-27 45
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family VFG1563 Protein 5e-30 41
PACID_20270 YP_006981176.1 Two component transcriptional regulator, winged helix family VFG1702 Protein 1e-29 41