Gene Information

Name : amad1_15595 (amad1_15595)
Accession : YP_006977966.1
Strain : Alteromonas macleodii AltDE1
Genome accession: NC_019393
Putative virulence/resistance : Resistance
Product : emrE protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3503197 - 3503526 bp
Length : 330 bp
Strand : +
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGACTTACTTATTATTAGCCATTGCTATCGTTACGGAAGTTACCGCTACCCTGCTACTTAAAATGTCTAATGGCTGGGA
AAAGTGGGCGTTCGGCTACGGCGCTATCTTTTTCTACACCGTCTCAGGGATGCTCTTTGCGATGGTACTAAAGAATATGG
GAATTGGCGTTGCCTATGCGATTTGGTCAGGTATGGGTATCGCGCTAATCACCGCTGCATCAGTGGTATTTTGGAAACAA
ACTTTCGACATTTATGCCGTGCTAGGTATTATGTTAATTATCTCGGGCACCTTGCTTATCACTAGCAAGTCAGCCGTTGT
ATTTCAGTAA

Protein sequence :
MTYLLLAIAIVTEVTATLLLKMSNGWEKWAFGYGAIFFYTVSGMLFAMVLKNMGIGVAYAIWSGMGIALITAASVVFWKQ
TFDIYAVLGIMLIISGTLLITSKSAVVFQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-06 41
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-06 41
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-06 41
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-06 41
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-06 41
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-06 41
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-06 41
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-06 41
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-06 41
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-06 41
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-06 41
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-06 41
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-06 41
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-06 41
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-06 41
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-06 41
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-06 41
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-06 41
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-06 41
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-06 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
amad1_15595 YP_006977966.1 emrE protein BAC0002 Protein 7e-10 45
amad1_15595 YP_006977966.1 emrE protein NC_010410.6003348.p0 Protein 7e-10 45
amad1_15595 YP_006977966.1 emrE protein NC_002695.1.913273.p Protein 7e-08 44
amad1_15595 YP_006977966.1 emrE protein BAC0377 Protein 4e-09 43
amad1_15595 YP_006977966.1 emrE protein CP004022.1.gene1549. Protein 6e-09 43
amad1_15595 YP_006977966.1 emrE protein BAC0150 Protein 8e-08 43
amad1_15595 YP_006977966.1 emrE protein BAC0323 Protein 7e-07 41
amad1_15595 YP_006977966.1 emrE protein BAC0322 Protein 2e-07 41