Gene Information

Name : yceD (BTB_502p04750)
Accession : YP_006930717.1
Strain :
Genome accession: NC_018878
Putative virulence/resistance : Resistance
Product : general stress protein 16U
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 281394 - 281972 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence :
ATGGTAATTCAATTACAAAAAGGACAAAAAGTAGACCTTACGAAAGGCAGAGAGAACCTTAAAAATGTAATGATTGGTTT
AGGTTGGGATGTTAACGAATTTGATGGTGGTCATGATTTTGACTTAGATGCATCTGCATTTTTATTAAATGCAAATGGTA
AATGTGCGAAAGATTTAGATTTCATTTTCTATAACAATCTAAAATCAACTTGTGGTTCTGTTGTTCATTCAGGTGACAAC
CTAACAGGTGGAGGAGACGGTGATGACGAGCAATTAGTGGTTCATTTAGACAAAGTACCTTCTACTGTTGACAAAATTGC
CTTTACTGTAACAATCTATGACGCACAAAAACGTTCTCAAAACTTTGGTCAAGTAAAAAATGCATTTGTACGTTTAGCAA
ATCAAGAAACAGGGGAGGAAATCTTCCGTTACGATTTAGGTGAAGACTTCTCAATTGAAACGGCTGTTGTGTTCTGTGAA
TTATACCGTCATAACGGTGAGTGGAAATTCAATGCTGTTGGAGCAGGTTTCCAAGGTGGATTGGCCGCACTTGTAAAAGC
ATATGGTTTAGATGCTTAA

Protein sequence :
MVIQLQKGQKVDLTKGRENLKNVMIGLGWDVNEFDGGHDFDLDASAFLLNANGKCAKDLDFIFYNNLKSTCGSVVHSGDN
LTGGGDGDDEQLVVHLDKVPSTVDKIAFTVTIYDAQKRSQNFGQVKNAFVRLANQETGEEIFRYDLGEDFSIETAVVFCE
LYRHNGEWKFNAVGAGFQGGLAALVKAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-48 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-48 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-49 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-48 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-39 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-42 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-42 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-42 53
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_006930717.1 general stress protein 16U BAC0389 Protein 1e-48 62
yceD YP_006930717.1 general stress protein 16U BAC0390 Protein 2e-43 53
yceD YP_006930717.1 general stress protein 16U BAC0392 Protein 7e-24 43