Gene Information

Name : phoP (DCF50_p2804)
Accession : YP_006914792.1
Strain : Dehalobacter sp. CF
Genome accession: NC_018867
Putative virulence/resistance : Virulence
Product : Two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2893962 - 2894657 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAAAAGAATCTTGGTTGTGGAAGATGAAGAAGCGATTGCCCGCCTGATCAGTTATAATCTTCAAAAAGAAGGATT
TGAAGTTCAGGTTTCAGGAGATGGACTTGAAGCACTGGGGAAAATTCGATCAGAAAAACCAGATTTGCTTATTCTCGATA
TTATGCTTCCTGGAATGGATGGCTATGAAATCTGCCAAGCAGTCAGGAAAGAAGACAGTTCTCTCCCTGTTATTATGTTG
TCGGCGAGAGATGATGAGCTGGATAAAATTCTTGGTCTGGAACTTGGCGGGGATGACTATCTGACAAAACCATTCAGTCC
GAGAGAGCTTATTGCCCGGGTACGCGCTTTATTGCGGCGGGCCCAAACGACTCAGGCAGCACCTGACCACGAGACTTTTT
TGATCGACAGGCTGGCTGTTGATTTTTCCGGACGTGAAATTAGCGTGAATGATCAGATTGTACCGCTTACGCCAAAGGAG
TTTGAACTGCTGGAGTATTTAATCCGCCATCGAGGAAAAGTGGTAAGCCGAGATCAGCTGTTAGACAGAGTATGGAACTA
TGATTTCGCGGGTGATACCAGGATTGTTGATGTTCATATCAGCAGGCTTCGAGAAAAAATTGAGCCCGACCCTAAAAACC
CGTCTTATATCCAGACGGTTCGCGGGGTCGGATACAGGTTTAAGGAGCGAGGCTGA

Protein sequence :
MSKRILVVEDEEAIARLISYNLQKEGFEVQVSGDGLEALGKIRSEKPDLLILDIMLPGMDGYEICQAVRKEDSSLPVIML
SARDDELDKILGLELGGDDYLTKPFSPRELIARVRALLRRAQTTQAAPDHETFLIDRLAVDFSGREISVNDQIVPLTPKE
FELLEYLIRHRGKVVSRDQLLDRVWNYDFAGDTRIVDVHISRLREKIEPDPKNPSYIQTVRGVGYRFKERG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-36 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_006914792.1 Two-component response regulator NC_003923.1003749.p0 Protein 1e-53 53
phoP YP_006914792.1 Two-component response regulator HE999704.1.gene2815. Protein 6e-52 53
phoP YP_006914792.1 Two-component response regulator NC_002952.2859905.p0 Protein 2e-53 52
phoP YP_006914792.1 Two-component response regulator NC_009782.5559369.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator NC_002951.3237708.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator NC_002758.1121668.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator NC_009641.5332272.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator NC_013450.8614421.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator NC_007793.3914279.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator NC_007622.3794472.p0 Protein 2e-53 52
phoP YP_006914792.1 Two-component response regulator NC_002745.1124361.p0 Protein 1e-53 52
phoP YP_006914792.1 Two-component response regulator AE016830.1.gene1681. Protein 4e-53 51
phoP YP_006914792.1 Two-component response regulator NC_012469.1.7686381. Protein 6e-52 50
phoP YP_006914792.1 Two-component response regulator NC_012469.1.7685629. Protein 1e-42 49
phoP YP_006914792.1 Two-component response regulator AE000516.2.gene3505. Protein 1e-45 47
phoP YP_006914792.1 Two-component response regulator NC_010400.5986590.p0 Protein 1e-35 45
phoP YP_006914792.1 Two-component response regulator NC_011595.7057856.p0 Protein 2e-35 45
phoP YP_006914792.1 Two-component response regulator NC_010410.6002989.p0 Protein 2e-35 45
phoP YP_006914792.1 Two-component response regulator AF162694.1.orf4.gene Protein 1e-37 45
phoP YP_006914792.1 Two-component response regulator AM180355.1.gene1830. Protein 2e-37 44
phoP YP_006914792.1 Two-component response regulator DQ212986.1.gene4.p01 Protein 1e-38 43
phoP YP_006914792.1 Two-component response regulator NC_014475.1.orf0.gen Protein 4e-34 43
phoP YP_006914792.1 Two-component response regulator NC_005054.2598277.p0 Protein 4e-34 43
phoP YP_006914792.1 Two-component response regulator EU250284.1.orf4.gene Protein 2e-39 43
phoP YP_006914792.1 Two-component response regulator BAC0308 Protein 6e-30 43
phoP YP_006914792.1 Two-component response regulator BAC0197 Protein 3e-30 42
phoP YP_006914792.1 Two-component response regulator HE999704.1.gene1528. Protein 3e-36 42
phoP YP_006914792.1 Two-component response regulator FJ349556.1.orf0.gene Protein 1e-34 42
phoP YP_006914792.1 Two-component response regulator AF130997.1.orf0.gene Protein 1e-32 41
phoP YP_006914792.1 Two-component response regulator BAC0347 Protein 1e-28 41
phoP YP_006914792.1 Two-component response regulator CP001138.1.gene4273. Protein 6e-23 41
phoP YP_006914792.1 Two-component response regulator NC_002695.1.915041.p Protein 4e-23 41
phoP YP_006914792.1 Two-component response regulator CP000034.1.gene3834. Protein 4e-23 41
phoP YP_006914792.1 Two-component response regulator AF155139.2.orf0.gene Protein 2e-34 41
phoP YP_006914792.1 Two-component response regulator CP001918.1.gene5135. Protein 4e-19 41
phoP YP_006914792.1 Two-component response regulator CP004022.1.gene3215. Protein 9e-27 41
phoP YP_006914792.1 Two-component response regulator CP004022.1.gene1676. Protein 4e-27 41
phoP YP_006914792.1 Two-component response regulator CP000647.1.gene2531. Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_006914792.1 Two-component response regulator VFG1563 Protein 8e-37 47
phoP YP_006914792.1 Two-component response regulator VFG1702 Protein 2e-36 46
phoP YP_006914792.1 Two-component response regulator VFG1386 Protein 3e-37 43
phoP YP_006914792.1 Two-component response regulator VFG1389 Protein 5e-33 43