Gene Information

Name : DHBDCA_p2459 (DHBDCA_p2459)
Accession : YP_006911471.1
Strain : Dehalobacter sp. DCA
Genome accession: NC_018866
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2508778 - 2509005 bp
Length : 228 bp
Strand : -
Note : -

DNA sequence :
ATGGCTATCAGTTATAACAAGCTTTGGAAGCTGCTAATCGATAAGGGTATGAATAAACAGGACCTTAAGCAAGCATCCGG
GATCAGCACTACCTCTATGGCGAAACTTGGAAAATGTGAGAACATCACGACAGACGTCCTGCTGAAGATCTGCAGGGCTC
TCGACTGCGATATTGCTGATATTATGGAGGTCGTGCCGGGTACAACAGTTATGAAGGCATCTGAGTAA

Protein sequence :
MAISYNKLWKLLIDKGMNKQDLKQASGISTTSMAKLGKCENITTDVLLKICRALDCDIADIMEVVPGTTVMKASE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cpfrc_01461 YP_003783861.1 hypothetical protein Not tested PiCp 5 Protein 1e-12 55
CpC231_1455 YP_005683818.1 hypothetical protein Not tested PiCp 5 Protein 8e-13 55
CpI19_1462 YP_005685904.1 hypothetical protein Not tested PiCp 5 Protein 8e-13 55
Cp1002_1456 YP_005681720.1 hypothetical protein Not tested PiCp 5 Protein 4e-12 53
SPN23F_09520 YP_002510935.1 regulatory protein Not tested PPI-1 Protein 2e-07 42
SP_1030 NP_345505.1 hypothetical protein Not tested PPI-1 Protein 2e-07 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DHBDCA_p2459 YP_006911471.1 hypothetical protein DQ212986.1.gene3.p01 Protein 3e-16 56