Gene Information

Name : SVEN_4031 (SVEN_4031)
Accession : YP_006879576.1
Strain : Streptomyces venezuelae ATCC 10712
Genome accession: NC_018750
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4365462 - 4366037 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCTGTGAGCCTGTCCAAGGGCGGCAACGTCTCTCTGACCAAGGAGGCCCCGGGCCTCGCCGCTGTCACCGTGGGCCT
CGGCTGGGACGTCCGTACGACCACCGGCACCGACTTCGACCTCGACGCCTCGGCGATCGGCGTGGACGCCGCCGGGAAGG
TCGCCTCCGACGCGCACTTCGTCTTCTTCAACAACAAGTCGACGCCGGACCAGACCATCGTCCACACCGGTGACAACCGC
ACCGGTGAGGGCGGCGGCGACGACGAGCAGATCAACGTCAACCTCGCGGCCCTCCCGCCGACCGTCGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGTCAGCCGCTCGCAGAACTTCGGCCAGGTCCGCAACGCGTACATCCGCATCGTGAACC
AGGCCGGCGGCGCCGAGCTCGCCCGCTACGACCTCTCCGAGGACGCCGCCGTCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCTCGGGCCTCGAGGGCATCGCCCGCGACTT
CGGCGTCAACCTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLAAVTVGLGWDVRTTTGTDFDLDASAIGVDAAGKVASDAHFVFFNNKSTPDQTIVHTGDNR
TGEGGGDDEQINVNLAALPPTVDKIVFPVSIYDAVSRSQNFGQVRNAYIRIVNQAGGAELARYDLSEDAAVETAMVFGEL
YRNGAEWKFRAVGQGYASGLEGIARDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-58 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-56 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-57 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-56 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SVEN_4031 YP_006879576.1 Tellurium resistance protein TerD BAC0390 Protein 2e-57 61
SVEN_4031 YP_006879576.1 Tellurium resistance protein TerD BAC0389 Protein 1e-55 60