Gene Information

Name : SVEN_3772 (SVEN_3772)
Accession : YP_006879317.1
Strain : Streptomyces venezuelae ATCC 10712
Genome accession: NC_018750
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4097086 - 4097829 bp
Length : 744 bp
Strand : +
Note : -

DNA sequence :
ATGACCGTCACCACACGCCGTCCCGGCACCCGCGCCGACATGCTCCGTGCCGACGGAACCGCCGTCCGTGTCCTCGTCGT
CGACGACGAGGCATCGCTCGCCGAGCTGCTCTCCATGGCTCTGCGCTACGAGGGCTGGCAGGTGCGCAGCGCCGGGGACG
GGGCCGCGGCCCTGCGCTCCGCGCGCGAGTTCCGGCCGGATGCCGTGATCCTCGACATCATGCTGCCCGACGTCGACGGG
CTGAGCCTGCTCGGTCGCATCCGGCGTGAACTGCCGGACGTTCCGGTGCTGTTCCTCACGGCGAAGGACGCCGTCGAGGA
CCGGATCGCCGGGCTCACCGCGGGCGGCGACGACTACGTCACCAAGCCCTTCAGCCTGGAGGAGGTCGTGGCCCGGCTGC
GCGGGCTCATCCGCAGGTCGGGCGCGGCGCTGGCCCGCAGCGAGTCGCTGCTCGTCGTCGGTGACCTGACCCTCGACGAG
GACAGCCACGAGGTCACCCGGGGCGGGGACTCCATCCATCTCACGGCGACCGAGTTCGAGCTGCTGCGCTATCTGATGCG
CAACCCCCGGCGGGTGCTCAGCAAGGCGCAGATCCTCGACCGCGTCTGGTCGTACGACTTCGGCGGTCAGGCCAACGTCG
TCGAGCTCTACATCTCGTATCTGCGGCGGAAGATCGACGCGGGGCGTGCCCCGATGATCCACACCCGGCGCGGGGCCGGT
TACCTGATCAAGCCGGGGGAGTAG

Protein sequence :
MTVTTRRPGTRADMLRADGTAVRVLVVDDEASLAELLSMALRYEGWQVRSAGDGAAALRSAREFRPDAVILDIMLPDVDG
LSLLGRIRRELPDVPVLFLTAKDAVEDRIAGLTAGGDDYVTKPFSLEEVVARLRGLIRRSGAALARSESLLVVGDLTLDE
DSHEVTRGGDSIHLTATEFELLRYLMRNPRRVLSKAQILDRVWSYDFGGQANVVELYISYLRRKIDAGRAPMIHTRRGAG
YLIKPGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SVEN_3772 YP_006879317.1 putative two-component system response regulator BAC0083 Protein 8e-33 47
SVEN_3772 YP_006879317.1 putative two-component system response regulator BAC0197 Protein 1e-33 46
SVEN_3772 YP_006879317.1 putative two-component system response regulator AE016830.1.gene1681. Protein 2e-35 44
SVEN_3772 YP_006879317.1 putative two-component system response regulator BAC0638 Protein 2e-26 43
SVEN_3772 YP_006879317.1 putative two-component system response regulator BAC0125 Protein 1e-29 42
SVEN_3772 YP_006879317.1 putative two-component system response regulator HE999704.1.gene2815. Protein 5e-34 42
SVEN_3772 YP_006879317.1 putative two-component system response regulator AE000516.2.gene3505. Protein 6e-31 42
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_002952.2859905.p0 Protein 8e-32 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_009782.5559369.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_002951.3237708.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_003923.1003749.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_002758.1121668.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_007622.3794472.p0 Protein 8e-32 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_009641.5332272.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_013450.8614421.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_007793.3914279.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator NC_002745.1124361.p0 Protein 1e-31 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator BAC0111 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SVEN_3772 YP_006879317.1 putative two-component system response regulator VFG1386 Protein 8e-55 56
SVEN_3772 YP_006879317.1 putative two-component system response regulator VFG1390 Protein 3e-43 47
SVEN_3772 YP_006879317.1 putative two-component system response regulator VFG1389 Protein 2e-42 47
SVEN_3772 YP_006879317.1 putative two-component system response regulator VFG0473 Protein 1e-25 41
SVEN_3772 YP_006879317.1 putative two-component system response regulator VFG0596 Protein 2e-26 41