Gene Information

Name : SVEN_2181 (SVEN_2181)
Accession : YP_006877726.1
Strain : Streptomyces venezuelae ATCC 10712
Genome accession: NC_018750
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2349007 - 2349582 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAATGTCTCCCTCTCCAAGGCCGCACCCAACCTCACCCAGGTCCTCGTCGGGCT
CGGCTGGGACGCGCGCTCCACCACCGGAGCCCCCTTCGACCTCGACGCCAGCGCGCTGCTGTGCCAGGCCGGACGGGTGC
TCGGCGACGAGTACTTCGTCTTCTACAACCAGCTGCGCAGCCCCGAGGGCTCGGTCGAACACACCGGCGACAACCTCACC
GGCGAGGGTGACGGGGACGACGAGTCCCTGATCGTGGACCTCTCCAAGGTGCCGGCCCACTGCGACAAGATCGTCTTCCC
GGTGTCGATCCATGACGCCGACAACCGGGGCCAGAGCTTCGGCCAGGTCAGCAACGCGTTCATCCGCGTCGTGAACCAGC
TCGACGGCCAGGAGCTCGCCCGCTACGACCTCTCCGAGGACGCCTCCACGGAGACCGCGATGATCTTCGGCGAGCTCTAC
CGCTACAACGGCGAATGGAAGTTCCGGGCGGTCGGTCAGGGGTACGCGTCCGGGCTCCGGGGCATCGCTCTAGACTTCGG
GGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVLVGLGWDARSTTGAPFDLDASALLCQAGRVLGDEYFVFYNQLRSPEGSVEHTGDNLT
GEGDGDDESLIVDLSKVPAHCDKIVFPVSIHDADNRGQSFGQVSNAFIRVVNQLDGQELARYDLSEDASTETAMIFGELY
RYNGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-61 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-53 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-53 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-53 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-53 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-25 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-25 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SVEN_2181 YP_006877726.1 Tellurium resistance protein TerD BAC0389 Protein 3e-57 68
SVEN_2181 YP_006877726.1 Tellurium resistance protein TerD BAC0390 Protein 3e-57 63
SVEN_2181 YP_006877726.1 Tellurium resistance protein TerD BAC0392 Protein 9e-25 43