Gene Information

Name : C380_09550 (C380_09550)
Accession : YP_006854248.1
Strain : Acidovorax sp. KKS102
Genome accession: NC_018708
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2077308 - 2078000 bp
Length : 693 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCATCCTGCTGGTAGAAGACGACACCCTGCTGCGCGCCCAGCTGCGCACGGCACTGCAAGGCGCGGGCTACACCGT
GGACGAGGCGGACAACGGCCGCGATGCGCAGTTCTTGGGCGAGACCGAGGCGGTGGATGCCGTGGTGCTGGACCTGGGCC
TGCCGGTGGTGGACGGGCTCACAGTGCTCAAGCGCTGGCGGGCTGCGGGGCGCAACATGCCAGTGCTGATCCTCACCGCG
CGCGACAACTGGCACGAAAAAGTCGCGGGCATCGACGCCGGTGCCGACGATTACCTGACCAAGCCCTTTCACCTCGAAGA
ACTGCTGGCGCGCCTGCGCGCACTCATCCGCCGCGCCAGCGGGCAGGCATCGGCCGTGCTGCAGTGCGGAGACTGGTCGC
TGGACACCCGCAGCGGCCGCGTGACTTGCGCGGGCCAGCCGGTGACGCTGACAGCCCATGAATACAAGGTGCTCGACTAC
CTGATGCACCGTCCCGGCGTGCTGGTCTCCCGTGCGGAACTGACCGAACACATCTACGCGCAGGACTTTGACCGGGACTC
GAACACCATCGAGGTGTTTGTGGGGCGCCTGCGCAAAAAGATGTTGCCCTCTGCAGGTTCGTCGGCGGACCCGGCGGCTT
CGGCCCGCATTGAGACCGTGCGTGGTATGGGCTACCGCCTGGTGCCGCCATGA

Protein sequence :
MRILLVEDDTLLRAQLRTALQGAGYTVDEADNGRDAQFLGETEAVDAVVLDLGLPVVDGLTVLKRWRAAGRNMPVLILTA
RDNWHEKVAGIDAGADDYLTKPFHLEELLARLRALIRRASGQASAVLQCGDWSLDTRSGRVTCAGQPVTLTAHEYKVLDY
LMHRPGVLVSRAELTEHIYAQDFDRDSNTIEVFVGRLRKKMLPSAGSSADPAASARIETVRGMGYRLVPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_09550 YP_006854248.1 two component response regulator BAC0530 Protein 9e-32 45
C380_09550 YP_006854248.1 two component response regulator NC_002516.2.879194.p Protein 2e-30 44
C380_09550 YP_006854248.1 two component response regulator BAC0487 Protein 3e-18 43
C380_09550 YP_006854248.1 two component response regulator CP004022.1.gene1005. Protein 2e-33 43
C380_09550 YP_006854248.1 two component response regulator CP000647.1.gene1136. Protein 1e-31 43
C380_09550 YP_006854248.1 two component response regulator CP001918.1.gene2526. Protein 1e-30 42
C380_09550 YP_006854248.1 two component response regulator CP001138.1.gene1939. Protein 3e-32 42
C380_09550 YP_006854248.1 two component response regulator BAC0083 Protein 4e-19 42
C380_09550 YP_006854248.1 two component response regulator CP000034.1.gene2022. Protein 2e-31 41
C380_09550 YP_006854248.1 two component response regulator NC_002695.1.913289.p Protein 2e-30 41
C380_09550 YP_006854248.1 two component response regulator BAC0638 Protein 4e-12 41
C380_09550 YP_006854248.1 two component response regulator BAC0197 Protein 3e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_09550 YP_006854248.1 two component response regulator VFG0473 Protein 2e-21 44
C380_09550 YP_006854248.1 two component response regulator VFG0475 Protein 3e-32 42
C380_09550 YP_006854248.1 two component response regulator VFG1390 Protein 4e-21 41
C380_09550 YP_006854248.1 two component response regulator VFG0596 Protein 3e-16 41