Gene Information

Name : C380_06225 (C380_06225)
Accession : YP_006853594.1
Strain : Acidovorax sp. KKS102
Genome accession: NC_018708
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1353681 - 1354367 bp
Length : 687 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAATTCTGCTCATCGAAGACGAAGTCAAGCTGGCTGAGTACCTGCGCAAGGGCCTGGGAGAGGCCGGCTACGTGGT
GGACATTGCGCACAACGGGGTGGATGGCCTGCACATGGCTCTGGAAGGCGTGCACGATCTGCTGGTCTTGGACGCGATGC
TCCCAGGGATCGACGGCTTCAGCCTTCTAACGGCCTTTCGCAAGACCAAGCAGACCCCGGTCTTGATGTTGACAGCAAGG
GTCAGCGTCGAGGATCGGGTGTTGGGACTCAAGACCGGTGCCGACGACTATCTGGTCAAGCCCTTTGCGTTTTCCGAACT
GAGCGCCCGCATCCAGGTGCTGCTGCGGCGGACCCATAGCGCGCGGGATGCCGCAGAGCCCACGCAACTGCGGTTGGGCG
ACCTGGAATTAGACCTGGTACGGCGCAAAGCGTCCCGGTGTGGCCAGCGCTTGGAGTTGACTGCGAAGGAGTTTCTGCTG
CTGACTCTGTTTCTGAGAAGAAAAGGCGAAGTGCTTTCTCGCACTGAGATCGCTGAGCAGGTGTGGGACATGAATTTCGA
TAGCGATACCAGCGTAGTGGAAGTCGCGATCCGGCGCCTCCGTACCAAGATCGATGTTCCGTTTGGCACTGCGCTGCTCC
ACACCATTCGCGGCATGGGATACGTGATGGAGGACCGCAACGGATGA

Protein sequence :
MKILLIEDEVKLAEYLRKGLGEAGYVVDIAHNGVDGLHMALEGVHDLLVLDAMLPGIDGFSLLTAFRKTKQTPVLMLTAR
VSVEDRVLGLKTGADDYLVKPFAFSELSARIQVLLRRTHSARDAAEPTQLRLGDLELDLVRRKASRCGQRLELTAKEFLL
LTLFLRRKGEVLSRTEIAEQVWDMNFDSDTSVVEVAIRRLRTKIDVPFGTALLHTIRGMGYVMEDRNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-54 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-53 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_06225 YP_006853594.1 two-component response regulator BAC0083 Protein 2e-56 58
C380_06225 YP_006853594.1 two-component response regulator BAC0197 Protein 1e-60 58
C380_06225 YP_006853594.1 two-component response regulator BAC0125 Protein 4e-59 57
C380_06225 YP_006853594.1 two-component response regulator BAC0638 Protein 5e-51 56
C380_06225 YP_006853594.1 two-component response regulator BAC0111 Protein 9e-58 54
C380_06225 YP_006853594.1 two-component response regulator BAC0347 Protein 3e-52 51
C380_06225 YP_006853594.1 two-component response regulator BAC0308 Protein 7e-52 50
C380_06225 YP_006853594.1 two-component response regulator CP001138.1.gene4273. Protein 6e-27 42
C380_06225 YP_006853594.1 two-component response regulator CP000647.1.gene4257. Protein 1e-26 41
C380_06225 YP_006853594.1 two-component response regulator BAC0533 Protein 1e-26 41
C380_06225 YP_006853594.1 two-component response regulator HE999704.1.gene1528. Protein 3e-31 41
C380_06225 YP_006853594.1 two-component response regulator NC_002695.1.915041.p Protein 5e-27 41
C380_06225 YP_006853594.1 two-component response regulator CP000034.1.gene3834. Protein 5e-27 41
C380_06225 YP_006853594.1 two-component response regulator CP001918.1.gene5135. Protein 5e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_06225 YP_006853594.1 two-component response regulator VFG0596 Protein 2e-54 53
C380_06225 YP_006853594.1 two-component response regulator VFG1390 Protein 9e-41 44
C380_06225 YP_006853594.1 two-component response regulator VFG1389 Protein 9e-36 44