Gene Information

Name : C380_06140 (C380_06140)
Accession : YP_006853577.1
Strain : Acidovorax sp. KKS102
Genome accession: NC_018708
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1334999 - 1335685 bp
Length : 687 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGAAGATATTGATCGTCGAGGATGAAATCAAAACCGGCGAATACCTGCGCCAAGGCTTGCGTGAGGCAGGGTTCAACGC
CGATCTGGTTCACAACGGAGTCGATGGCCTGCATCTGGCCCAGGAAGGTGACTACGACCTGGTGATCCTGGATGTGATGC
TTCCTGGGATGGATGGCTGGCAGGTGCTCACCAATCTGCGTCGCCGGGGCCTGGAGATGCCCGTACTGTTTCTCACGGCC
AAGGATCAGGTGCAAGACCGGATCAAAGGGTTGGAACTGGGGGCGGACGACTACCTGGTCAAACCGTTTTCCTTTGCCGA
GCTATTGGCGCGAGCGCGCACCATCCTCAGGCGTGGTCGCAATGGCACCGAGGTGACGGTCCTCCAGGTGGCCGATCTAG
AACTAGACCTCTTGCGGCGGCGAGTCAGCAGATCTGGCAAACGCATCGACCTCACGGCCAAGGAGTTCGGACTCCTGGAG
CTGCTGATGCGCCGCCAAGGGGAAGTTCTGCCGCGCTCTCTGATCGCGTCGCAGGTGTGGGATATGAATTTCGACAGCGA
TTCCAACGTGATTGAGGTGGCGATGCGCAGGCTTCGGGCCAAGATTGACGATGCCTATGACGCCAAGCTGATTCAGACGG
TGCGAGGCATGGGTTATGTGCTTGAGGCACCCCAGGAGAATGTGTGA

Protein sequence :
MKILIVEDEIKTGEYLRQGLREAGFNADLVHNGVDGLHLAQEGDYDLVILDVMLPGMDGWQVLTNLRRRGLEMPVLFLTA
KDQVQDRIKGLELGADDYLVKPFSFAELLARARTILRRGRNGTEVTVLQVADLELDLLRRRVSRSGKRIDLTAKEFGLLE
LLMRRQGEVLPRSLIASQVWDMNFDSDSNVIEVAMRRLRAKIDDAYDAKLIQTVRGMGYVLEAPQENV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-59 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-58 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-74 69
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0197 Protein 6e-73 68
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0638 Protein 6e-67 67
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0308 Protein 9e-71 66
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-72 65
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-70 63
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-66 62
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-35 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 4e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 3e-34 41
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator VFG0596 Protein 8e-60 59
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-43 44
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator VFG1386 Protein 1e-38 44
C380_06140 YP_006853577.1 two component heavy metal response transcriptional regulator VFG1389 Protein 5e-35 41