Gene Information

Name : C380_06095 (C380_06095)
Accession : YP_006853568.1
Strain : Acidovorax sp. KKS102
Genome accession: NC_018708
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1327155 - 1327577 bp
Length : 423 bp
Strand : +
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGAACGAAGGTTTGGGTGATTGGATGACGGTTGGCAGGCTGGCGAAGGTCGCTGGCGTCGGCGTGGAGACAATCCGCTA
CTACCAGGGACGCGGCCTGTTGCCGATCCCGAAGAACGCCGGCAGCTTCCGGCGCTACCCCGCTTCGATGATCCAGCGGA
TCGGCTTCATCAAGCGCGCTCAGAGCCTTGGGTTCTCGCTGGACGAGGTGAAGTCGCTCTTGGATCTGGAGGATGGGCGG
AATCGCCGGGCTATTCAGACGGTGACACGGCGGCGCCTTGACCAGATCGATGAGAAGGTTGGCGACCTTCAGCGCATGCG
AGGCGCTCTGAGAGACATGCTGGAGAGGTGCGAAGACACGGGAGAGGCGCTTCCTTGCCCTATCATTGCTGCGCTCATGG
GGCCTTTGAATACGTCCGAATGA

Protein sequence :
MNEGLGDWMTVGRLAKVAGVGVETIRYYQGRGLLPIPKNAGSFRRYPASMIQRIGFIKRAQSLGFSLDEVKSLLDLEDGR
NRRAIQTVTRRRLDQIDEKVGDLQRMRGALRDMLERCEDTGEALPCPIIAALMGPLNTSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-25 45
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-24 45
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-23 44
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-24 43
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-24 43
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-24 43
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-24 43
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-24 43
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-24 43
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-24 43
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0684 Protein 1e-26 45
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0683 Protein 2e-26 44
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0688 Protein 8e-26 44
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0689 Protein 9e-24 44
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0232 Protein 1e-24 43
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0686 Protein 2e-25 43
C380_06095 YP_006853568.1 MerR family transcriptional regulator BAC0687 Protein 1e-24 43