Gene Information

Name : C380_05675 (C380_05675)
Accession : YP_006853488.1
Strain : Acidovorax sp. KKS102
Genome accession: NC_018708
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1241372 - 1241647 bp
Length : 276 bp
Strand : +
Note : COG2608 Copper chaperone

DNA sequence :
ATGAAACAACTACTTGCCTCCCTGGCGCTCACCCTGGCCGTTGTCCCCGTGTGGGCCGCCACCCAGACCGTCATGCTGGC
CATTCCCGGCATGACCTGCTCCACCTGCCCGATCATCGTCAAAAAAGCGCTTTCCAAGATCGAAGGCGTTAGCGAAGTTG
AGGTGACCTTTGAGACGCGCGACGCAGCTGTCACCTTCGATGACGCAAAGACCAGCGTGCAGAAGCTGACCAAGGCAACC
GCAGAGGTGGGGTTTCCATCCAGTGTCAAGCGGTGA

Protein sequence :
MKQLLASLALTLAVVPVWAATQTVMLAIPGMTCSTCPIIVKKALSKIEGVSEVEVTFETRDAAVTFDDAKTSVQKLTKAT
AEVGFPSSVKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 4e-22 75
merP AGK07023.1 MerP Not tested SGI1 Protein 4e-22 75
merP AGK07081.1 MerP Not tested SGI1 Protein 4e-22 75
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 5e-22 75
merP ABQ57373.1 MerP Not tested SGI1 Protein 4e-22 75
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 4e-22 75
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-21 70
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-21 70
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-23 66
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 5e-19 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_05675 YP_006853488.1 mercuric transport protein periplasmic protein BAC0678 Protein 7e-23 79
C380_05675 YP_006853488.1 mercuric transport protein periplasmic protein BAC0231 Protein 6e-23 78
C380_05675 YP_006853488.1 mercuric transport protein periplasmic protein BAC0679 Protein 3e-23 78
C380_05675 YP_006853488.1 mercuric transport protein periplasmic protein BAC0675 Protein 3e-20 68
C380_05675 YP_006853488.1 mercuric transport protein periplasmic protein BAC0674 Protein 3e-17 53