Gene Information

Name : C380_05665 (C380_05665)
Accession : YP_006853486.1
Strain : Acidovorax sp. KKS102
Genome accession: NC_018708
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1240507 - 1240935 bp
Length : 429 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGAAAGCCAATTTGGAGAGTTTTACGATCGGCGCTTTTGCCGAGGCGGCCGGGGTCAATGTAGAGACCATCCGGTTCTA
TCAGCGCAAGGGATTGTTGCCCGAGCCGGCCAAGCCTCACGGCAGCATCCGCCGCTATGGAGATGCAGATGTGACGCGGG
TGCGCTTCGTCAAAGCGGCTCAGCGCCTGGGCTTCAGCCTGGATGCAATAGCCGAGCTGCTGCGGCTAGACGATGGAACT
CATTGTGAAGAAGCCAGCGCACTGGCTGAGTCCAAGCTCAAGGATGTGCGCGAGAAGATAGCCGATTTGGCACGCATGGA
GTCGGTGCTGTCTGAACTGGTATGCGCATGCCATGCGAGAAAAGGGAATGTCTCCTGCCCGCTGATTGCGTCGCTGCAGG
ACGGCGGGAGACTCTCGTTGCCGCAATGA

Protein sequence :
MKANLESFTIGAFAEAAGVNVETIRFYQRKGLLPEPAKPHGSIRRYGDADVTRVRFVKAAQRLGFSLDAIAELLRLDDGT
HCEEASALAESKLKDVREKIADLARMESVLSELVCACHARKGNVSCPLIASLQDGGRLSLPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-54 86
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 8e-55 86
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-52 84
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-52 84
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-52 84
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-52 84
merR AGK07025.1 MerR Not tested SGI1 Protein 8e-52 83
merR AGK07083.1 MerR Not tested SGI1 Protein 8e-52 83
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-45 75
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-41 67
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-25 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0686 Protein 4e-51 86
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0688 Protein 3e-53 86
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0687 Protein 1e-53 85
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0232 Protein 1e-53 85
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0684 Protein 8e-54 84
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0683 Protein 1e-53 83
C380_05665 YP_006853486.1 transcriptional regulator MerR BAC0689 Protein 1e-52 81