Gene Information

Name : PAC1_01845 (PAC1_01845)
Accession : YP_006850378.1
Strain : Propionibacterium acnes C1
Genome accession: NC_018707
Putative virulence/resistance : Virulence
Product : sensory transduction protein RegX
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 410162 - 410842 bp
Length : 681 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACCCGTGTACTCATCATCGAGGACGAAGAGTCCTATCGCGAGGCCACCGCCTTCATGCTGCGCAAAGAGGGATTTGA
GGTCAATACTGCCGCCAATGGCGCTGATGGTCTCGAAATCTACTCGCACAACGGTGCCGACATCGTACTGCTCGACCTCA
TGATGCCAGGGCTTCCAGGGACCGAAGTCTGCCGTCAGCTACGCCAGCGCGGCAATGTCGGGATCATCATGGTGACGGCT
AGGGATTCGGAGATCGACAAGGTTGTCGGGCTGGAGCTCGGAGCCGACGACTACGTCACCAAACCGTTTAGCCACCGAGA
ATTGGTCGCGCGCATCCGCGCTGTGACTCGTCGCGGCGGCCCTGAGATAGAGGTTTCCCCCGATGTGCTCGAGGAGAGCG
GGGTAAGGATGGACGTTGAGCGGCATGAGGTCAGCGTCGGCGGGACGGCAGTGCGACTTGCCCTCAAAGAGTTCGACCTA
CTTGAGGTGCTGCTGCGCAATGCAGGACGTGTCATGACCCGAGCCTCCCTCATCGACCGAGTGTGGGGAGCCGACTATGT
TGGCGACACTAAAACTCTTGACGTGCACATCAAAAGGCTGCGCGCAAAGATTGAAGATGACCCATCCCGTCCGGTGCGCA
TCATCACCGTACGCGGACTGGGCTACAAGTTTCAGGCCTAA

Protein sequence :
MTRVLIIEDEESYREATAFMLRKEGFEVNTAANGADGLEIYSHNGADIVLLDLMMPGLPGTEVCRQLRQRGNVGIIMVTA
RDSEIDKVVGLELGADDYVTKPFSHRELVARIRAVTRRGGPEIEVSPDVLEESGVRMDVERHEVSVGGTAVRLALKEFDL
LEVLLRNAGRVMTRASLIDRVWGADYVGDTKTLDVHIKRLRAKIEDDPSRPVRIITVRGLGYKFQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_012469.1.7685629. Protein 2e-47 46
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_012469.1.7686381. Protein 1e-45 44
PAC1_01845 YP_006850378.1 sensory transduction protein RegX AE000516.2.gene3505. Protein 4e-41 44
PAC1_01845 YP_006850378.1 sensory transduction protein RegX HE999704.1.gene2815. Protein 7e-44 43
PAC1_01845 YP_006850378.1 sensory transduction protein RegX AE016830.1.gene1681. Protein 3e-47 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_002952.2859905.p0 Protein 3e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_009641.5332272.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_013450.8614421.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_007793.3914279.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_002745.1124361.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_009782.5559369.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_002951.3237708.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_003923.1003749.p0 Protein 4e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_002758.1121668.p0 Protein 5e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX NC_007622.3794472.p0 Protein 2e-42 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX AE015929.1.gene1106. Protein 6e-33 41
PAC1_01845 YP_006850378.1 sensory transduction protein RegX BAC0638 Protein 9e-26 41
PAC1_01845 YP_006850378.1 sensory transduction protein RegX HE999704.1.gene1528. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAC1_01845 YP_006850378.1 sensory transduction protein RegX VFG1386 Protein 7e-34 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX VFG1389 Protein 5e-30 42
PAC1_01845 YP_006850378.1 sensory transduction protein RegX VFG0596 Protein 7e-33 41
PAC1_01845 YP_006850378.1 sensory transduction protein RegX VFG1390 Protein 7e-36 41