Gene Information

Name : M3Q_2661 (M3Q_2661)
Accession : YP_006848980.1
Strain : Acinetobacter baumannii TYTH-1
Genome accession: NC_018706
Putative virulence/resistance : Resistance
Product : cation/cationic drug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2825148 - 2825495 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence : 
ATGAAAGGCTGGCTTTTTCTTGTTATCGCAATAGTTGGCGAAGTAATCGCAACATCCGCATTAAAATCTAGCGAGGGCTT
TACTAAGCTTGCCCCTTCCGCCGTTGTCATAATCGGTTATGGCATCGCATTTTATTTTCTTTCTCTGGTTCTGAAATCCA
TCCCTGTCGGTGTTGCTTATGCAGTCTGGTCGGGACTCGGCGTCGTCATAATTACAGCCATTGCCTGGTTGCTTCATGGG
CAAAAGCTTGATGCGTGGGGCTTTGTAGGTATGGGGCTCATAATTGCTGCCTTTTTGCTCGCCCGATCCCCATCGTGGAA
GTCGCTGCGGAGGCCGACGCCATGGTGA

Protein sequence : 
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHG
QKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-46 100
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-46 100
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-46 100
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-46 100
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-46 100
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-46 100
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-46 100
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-46 100
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-46 100
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-46 100
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-46 100
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-46 100
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-46 100

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0323 Protein 7e-47 100
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0322 Protein 5e-38 89
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0324 Protein 3e-31 72
M3Q_2661 YP_006848980.1 cation/cationic drug transporter CP001138.1.gene1489. Protein 3e-18 56
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0377 Protein 2e-17 54
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0002 Protein 2e-21 51
M3Q_2661 YP_006848980.1 cation/cationic drug transporter NC_010410.6003348.p0 Protein 2e-21 51
M3Q_2661 YP_006848980.1 cation/cationic drug transporter CP004022.1.gene1549. Protein 2e-18 50
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0329 Protein 4e-15 47
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0327 Protein 5e-14 46
M3Q_2661 YP_006848980.1 cation/cationic drug transporter AE000516.2.gene3301. Protein 5e-09 46
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0249 Protein 5e-09 46
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0325 Protein 3e-13 46
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0192 Protein 2e-14 46
M3Q_2661 YP_006848980.1 cation/cationic drug transporter NC_002695.1.913273.p Protein 2e-13 44
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0150 Protein 1e-13 44
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0139 Protein 2e-14 44
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0140 Protein 3e-13 42
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0321 Protein 3e-15 42
M3Q_2661 YP_006848980.1 cation/cationic drug transporter BAC0326 Protein 3e-14 42