Gene Information

Name : AXY_06550 (AXY_06550)
Accession : YP_006844549.1
Strain : Amphibacillus xylanus NBRC 15112
Genome accession: NC_018704
Putative virulence/resistance : Resistance
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 680281 - 680952 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGGCAGTCATATTAGTTGTTGATGATGATGACCATATCCGTCAATTAATAGCATTATACTTAAAGAATCATCACTTTGA
AGTTGTTGAAGCTAGAAATGGATATGAGGCAATTGAAAAGCTCGAGCAAAATCCGATTGATTTAGCGATCGTTGATATTA
TGATGCCAAAAATGGATGGTATTGAGTTAACAAAGGAAATAAGACAATACTATTCAATACCGATCCTTATGGTAACAGCT
AAAGGTGCTTCAGAAGATAAAGTCTCTGGTTTTGAGGCAGGTACAGATGATTATTTAGTTAAACCATTCGACCCAATTGA
ACTCGTATTAAGAGTAAAAGCTCTACTAAAAAGGTATAACATTAATGTAGAAAGAAATAATCGAATTGGTACGATCGAAA
TTGATTTGGATCGATTGATTGTCTCTGATGGTGAAACAACCGTTGAGCTAAAAAGGAAAGAGTGTGAACTCCTATTGGAG
CTATCATTTGAACCCGGCCGGATTTTTACAAGAGCCCAATTAGTTGAAAAGATATGGGGCTTTGATTATGAAGGTGATGA
ACGAACGGTAGATGTCCACATTAAACGATTACGTGAAAAATTAGCTCCCTTTAAGGAATTAAAAATCACCACTGTAAGAG
GGCTAGGCTACCGTTTAGAGGATGTGACGTAA

Protein sequence :
MAVILVVDDDDHIRQLIALYLKNHHFEVVEARNGYEAIEKLEQNPIDLAIVDIMMPKMDGIELTKEIRQYYSIPILMVTA
KGASEDKVSGFEAGTDDYLVKPFDPIELVLRVKALLKRYNINVERNNRIGTIEIDLDRLIVSDGETTVELKRKECELLLE
LSFEPGRIFTRAQLVEKIWGFDYEGDERTVDVHIKRLREKLAPFKELKITTVRGLGYRLEDVT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-30 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXY_06550 YP_006844549.1 two-component system response regulator NC_003923.1003749.p0 Protein 4e-31 46
AXY_06550 YP_006844549.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_009641.5332272.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_013450.8614421.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_007793.3914279.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_007622.3794472.p0 Protein 4e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_002745.1124361.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_009782.5559369.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_002951.3237708.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_002758.1121668.p0 Protein 5e-31 45
AXY_06550 YP_006844549.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-29 43
AXY_06550 YP_006844549.1 two-component system response regulator AF310956.2.orf0.gene Protein 1e-30 42
AXY_06550 YP_006844549.1 two-component system response regulator U35369.1.gene1.p01 Protein 2e-30 42
AXY_06550 YP_006844549.1 two-component system response regulator AE016830.1.gene2255. Protein 2e-30 42