Gene Information

Name : AXY_14040 (AXY_14040)
Accession : YP_006845298.1
Strain : Amphibacillus xylanus NBRC 15112
Genome accession: NC_018704
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1442877 - 1443080 bp
Length : 204 bp
Strand : +
Note : -

DNA sequence :

ATGTCAATAAGTTATAAAAGACTCTGGAAACTTCTTATTGATAGAGACATGAAAAAGAAAGACTTAATAGAAGCATCTGG
TATTAGTACTGCTTCAATGGCCAAGCTTGGGAGAGGTGATAATATCACCACAGAGGTGCTACTTAAGATATGTAAAGCAC
TAGATTGTGAACTAGAAGATATTATGGAGATCGACCGTGGTTAA

Protein sequence :

MSISYKRLWKLLIDRDMKKKDLIEASGISTASMAKLGRGDNITTEVLLKICKALDCELEDIMEIDRG

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
cpfrc_01461	YP_003783861.1	hypothetical protein	Not tested	PiCp 5	Protein	5e-13	56
CpC231_1455	YP_005683818.1	hypothetical protein	Not tested	PiCp 5	Protein	4e-13	56
CpI19_1462	YP_005685904.1	hypothetical protein	Not tested	PiCp 5	Protein	4e-13	56
Cp1002_1456	YP_005681720.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-12	55
EFAU085_00700	YP_008394224.1	putative transcriptional regulator	Not tested	Not named	Protein	9e-12	41

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
AXY_14040	YP_006845298.1	hypothetical protein	DQ212986.1.gene3.p01	Protein	5e-15	56