Gene Information

Name : BUPH_03442 (BUPH_03442)
Accession : YP_006835195.1
Strain :
Genome accession: NC_018695
Putative virulence/resistance : Virulence
Product : two-component system OmpR family response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3442927 - 3443595 bp
Length : 669 bp
Strand : -
Note : identified by sequence similarity; putative

DNA sequence :
GTGACCATGCGCATCTTGCTAGTCGAAGACGACCGGATGATCGCCGAAGGCGTGCGCAAGGCGCTGCGCGGCGAAGGCTT
CGCGGTCGACTGGGTGGAAGACGGCGAAGCGGCGCTCAGCGCGGCCGCGAACCAGCCGTACGATCTCGTGCTGCTCGACC
TGGGCTTGCCGAAGCGCGACGGCCTCGACGTGTTGCGCACCTTGCGCGCGCGGGGCCACGCGTTGCCGGTGCTGATCGTG
ACTGCGCGCGACGCGGTGGCCGACCGCGTGAAAGGCCTTGACGCCGGCGCGGACGATTACCTCGTCAAGCCTTTCGATCT
CGACGAACTGGGCGCCCGCATGCGGGCGCTGATCCGCCGCCAGGCGGGCCGCAGCGATTCGACGATCCGCCACGGCAATC
TCACGCTTGATCCCGCGTCGCATCAGGTGACGCTCGACGGCGCGCCGGTCGCCCTGTCCGCGCGCGAGTTCGCGCTGCTC
GAGGCGCTGCTCGCGCGGCCGGGCGCAGTGCTGTCGAAGAGTCAGCTCGAGGAAAAAATGTACGGCTGGGGCGAGGAGAT
CGGCAGCAATACCGTCGAGGTCTACATTCACGCGCTGCGCAAGAAGCTCGGCGCGGACCTGATCCGCAATGTGCGCGGCC
TCGGCTACATGATCGCGAAGGAAGCCTGA

Protein sequence :
MTMRILLVEDDRMIAEGVRKALRGEGFAVDWVEDGEAALSAAANQPYDLVLLDLGLPKRDGLDVLRTLRARGHALPVLIV
TARDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSDSTIRHGNLTLDPASHQVTLDGAPVALSAREFALL
EALLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGADLIRNVRGLGYMIAKEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-41 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-29 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator BAC0487 Protein 6e-39 49
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator BAC0197 Protein 3e-35 45
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator BAC0083 Protein 1e-31 44
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator NC_002516.2.879194.p Protein 8e-30 43
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator BAC0638 Protein 1e-29 43
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator U82965.2.orf14.gene. Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator VFG0473 Protein 1e-39 48
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator VFG1390 Protein 2e-35 46
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator VFG0596 Protein 1e-29 42
BUPH_03442 YP_006835195.1 two-component system OmpR family response regulator VFG1389 Protein 5e-27 42