Gene Information

Name : BUPH_02363 (BUPH_02363)
Accession : YP_006834114.1
Strain :
Genome accession: NC_018695
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein, SMR family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2134824 - 2135162 bp
Length : 339 bp
Strand : -
Note : identified by sequence similarity; putative

DNA sequence :
ATGCGGGTGCCGCCTTATGCATTGCTCGGCATCGCCATCGTGGCCGAAGTGATTGCGACCTCGGCGATGCGGGCGTCGGA
CGGGTTCTCGCGGTTCGTGCCGTCGGCGGTGGTCGTGCTCGGCTACGCCGTCGCCTTTTACTGCCTGTCGCTCACGCTGC
GCAGTATTCCGGTCGGCATCGTCTACGCGGTGTGGTCGGGCGCCGGCATCGTGCTGATCACGCTCGTCGCGCTGCTGCTG
TACGGCCAGGTGCCCGATGTGCCGGCCGTTATCGGCCTTGGGCTGATCATCGCGGGCGTTGCCGTCCTGAACATGTTTTC
GAAGATGCAGGCGCATTGA

Protein sequence :
MRVPPYALLGIAIVAEVIATSAMRASDGFSRFVPSAVVVLGYAVAFYCLSLTLRSIPVGIVYAVWSGAGIVLITLVALLL
YGQVPDVPAVIGLGLIIAGVAVLNMFSKMQAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 61
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-20 61
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 61
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-20 61
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 8e-21 61
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 61
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-20 61
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 8e-21 61
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 8e-21 61
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 8e-21 61
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 8e-21 61
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 8e-21 61
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 8e-21 61
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 8e-21 61
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 8e-21 61
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-20 61
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 8e-21 61
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 8e-21 61
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 61
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-20 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0322 Protein 6e-25 61
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0323 Protein 4e-21 61
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0324 Protein 4e-24 58
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family NC_010410.6003348.p0 Protein 1e-22 58
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0002 Protein 1e-22 58
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family CP001138.1.gene1489. Protein 1e-24 58
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0377 Protein 2e-23 55
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family CP004022.1.gene1549. Protein 9e-20 52
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family NC_002695.1.913273.p Protein 4e-18 50
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0150 Protein 5e-18 49
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0192 Protein 9e-17 48
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0139 Protein 2e-16 44
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0140 Protein 3e-14 42
BUPH_02363 YP_006834114.1 small multidrug resistance protein, SMR family BAC0329 Protein 7e-14 41