Gene Information

Name : B5T_03357 (B5T_03357)
Accession : YP_006821967.1
Strain : Alcanivorax dieselolei B5
Genome accession: NC_018691
Putative virulence/resistance : Resistance
Product : cation/cationic drug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3742519 - 3742851 bp
Length : 333 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAACGGACTGTTCCTGTTGATTGCCATTGTCTCCGAGGTGGCGGCGACGTCGGCGTTGAAAGCCAGTGAAGGCTT
CACCCGGCTGTGGCCGTCGCTGGTGGTGGTGTTGGGGTACGGGTTGGCGTTCTACTTCCTGTCGCTGACGTTGCGAGTGA
TTCCGGTGGGCGTGGCCTACGCCATATGGTCTGGTCTGGGCGTGGTGTTGGTGGCTTTGCTGTCCTGGCTGATCTATGGG
CAAAAGCTGGATGCACCGGCGATGTTGGGCATGGCGCTGATCATTAGCGGTGTGGTGGTAATGAATCTGTTCTCCAGTTC
CTCGGCTCATTGA

Protein sequence :
MKNGLFLLIAIVSEVAATSALKASEGFTRLWPSLVVVLGYGLAFYFLSLTLRVIPVGVAYAIWSGLGVVLVALLSWLIYG
QKLDAPAMLGMALIISGVVVMNLFSSSSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 69
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-18 69
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-18 69
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-18 69
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-18 69
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-18 69
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 69
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-18 69
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 69
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-18 69
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 69
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-18 69
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 69
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-18 69
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-18 69
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 69
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-18 69
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 69
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 69
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-18 69
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 9e-14 48
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 7e-10 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0322 Protein 8e-23 70
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0323 Protein 2e-18 69
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0324 Protein 4e-20 67
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0377 Protein 2e-21 61
B5T_03357 YP_006821967.1 cation/cationic drug transporter CP004022.1.gene1549. Protein 1e-18 59
B5T_03357 YP_006821967.1 cation/cationic drug transporter CP001138.1.gene1489. Protein 5e-17 59
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0002 Protein 3e-16 56
B5T_03357 YP_006821967.1 cation/cationic drug transporter NC_010410.6003348.p0 Protein 3e-16 56
B5T_03357 YP_006821967.1 cation/cationic drug transporter NC_002695.1.913273.p Protein 6e-15 53
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0150 Protein 6e-15 52
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0139 Protein 2e-11 49
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0140 Protein 6e-11 47
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0192 Protein 3e-11 46
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0325 Protein 2e-13 44
B5T_03357 YP_006821967.1 cation/cationic drug transporter BAC0321 Protein 5e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B5T_03357 YP_006821967.1 cation/cationic drug transporter VFG1586 Protein 4e-14 48
B5T_03357 YP_006821967.1 cation/cationic drug transporter VFG1587 Protein 3e-10 48