Gene Information

Name : O3I_036915 (O3I_036915)
Accession : YP_006812304.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8286317 - 8286892 bp
Length : 576 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGAGCGTCACACTGGCGAAGGGCGGCAACGTTTCGCTGTCCAAGCAGGCAGCCAACCTCAGCAAGGTAGCCGTGGGTCT
GGGGTGGGACGTGCGCACCACCACCGGTGCGGACTACGACCTGGACGCGAGCGCGCTGGCCACCGGGCAGAATCTGAAGG
TGCTCTCCGATCAGCACTTCGTGTTCTACAACAACCTGCGCTCGCCCGAGGGCTCGATCGAGCACACCGGCGACAACCTC
ACCGGCGAGGGTGAGGGCGACGACGAGGTGATCAACGTCGATCTGAGCGCGACCCCGCCGACCATCACCAACATCTTCTT
CCCGGTGTCGATTCACGACGCCGACGCGCGCGGCCAGTCGTTCGGCCAGATCCGCAACGCGTTCATCCGCGTGGTGGACG
CGGCGACCGGCATCGAGCTCGCGCGCTACGACCTGACCGAGGACGCCTCGACCGAAACCGCGATGGTCTTCGGCGAGCTG
TACCGCCACGGCAACGAGTGGAAGTTCCGCGCCATCGGCCAGGGGTACGCCTCGGGCCTCGCGGGTATCGCCCGCGACTA
CGGCGTCAATATCTGA

Protein sequence :
MSVTLAKGGNVSLSKQAANLSKVAVGLGWDVRTTTGADYDLDASALATGQNLKVLSDQHFVFYNNLRSPEGSIEHTGDNL
TGEGEGDDEVINVDLSATPPTITNIFFPVSIHDADARGQSFGQIRNAFIRVVDAATGIELARYDLTEDASTETAMVFGEL
YRHGNEWKFRAIGQGYASGLAGIARDYGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-56 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-56 63
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-56 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-54 61
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 59
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-55 58
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 58
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 58
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-29 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_036915 YP_006812304.1 hypothetical protein BAC0389 Protein 8e-56 62
O3I_036915 YP_006812304.1 hypothetical protein BAC0390 Protein 2e-57 59
O3I_036915 YP_006812304.1 hypothetical protein BAC0392 Protein 5e-25 42