Gene Information

Name : O3I_033750 (O3I_033750)
Accession : YP_006811673.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7627390 - 7628064 bp
Length : 675 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGGCGCGCATCCTGCTGATAGAGGACGACCCGCTGATCCGGGACAGCCTCGCGATGGCGCTGCGGCGGCACGGCCACGA
GGTGCGCGTCGCGGCGTCGGGGGAGGAGGGGCTGTCCTTGGCCGCGGACGGGGTCGAGCTCGTGGTGCTGGATGTGATGC
TGCCCGGCATGGACGGCTTCGAGGTCTGTCGGCGGCTGCGGGCGCGGGGTGACGTCGCCGTCATCATGCTCACCGCGCGC
GAGGACGACATCGACGTGGTGGGTGGGCTGGAGGCGGGGGCCGACGATTACGTGGTCAAGCCGGTGCTGCCGCGGGTGTT
GGACGCGCGCATCAAGGCGGTGCTGCGCCGGGGCGGCCGGGACGTGCAGAGCGGCACCGTGCGATTCGGGGAGCTCGAGA
TCGACCGTGACGGGCTGACGGTGGCGAAGAACGGAGTCGCGGTGGCGCTGACGCGGACCGAGCTGCGTCTGCTGCTGGAG
CTTTCCGGCGCCCCGGGGCAGGTTTTCAGCCGCCAGCAGCTGCTCGAACGCGTGTGGGAGCACGATTACCTCGGCGATTC
GCGCTTGGTGGACAACGGGATCCAGCGGCTGCGCGCCAAGATCGAAGGCGATCCGGCCGCGCCGCTGTTCGTGCAGACGG
TGCGCGGCTTCGGCTACCGGTTCGGGCCGATATGA

Protein sequence :
MARILLIEDDPLIRDSLAMALRRHGHEVRVAASGEEGLSLAADGVELVVLDVMLPGMDGFEVCRRLRARGDVAVIMLTAR
EDDIDVVGGLEAGADDYVVKPVLPRVLDARIKAVLRRGGRDVQSGTVRFGELEIDRDGLTVAKNGVAVALTRTELRLLLE
LSGAPGQVFSRQQLLERVWEHDYLGDSRLVDNGIQRLRAKIEGDPAAPLFVQTVRGFGYRFGPI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 8e-25 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 7e-24 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 8e-25 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 8e-25 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 8e-25 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-24 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_033750 YP_006811673.1 two-component system response regulator AE000516.2.gene3505. Protein 6e-35 46
O3I_033750 YP_006811673.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-36 41
O3I_033750 YP_006811673.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-36 41
O3I_033750 YP_006811673.1 two-component system response regulator BAC0197 Protein 7e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_033750 YP_006811673.1 two-component system response regulator VFG1389 Protein 1e-21 45
O3I_033750 YP_006811673.1 two-component system response regulator VFG1390 Protein 3e-27 41
O3I_033750 YP_006811673.1 two-component system response regulator VFG1563 Protein 3e-24 41
O3I_033750 YP_006811673.1 two-component system response regulator VFG1702 Protein 4e-24 41