Gene Information

Name : O3I_031460 (O3I_031460)
Accession : YP_006811215.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7123027 - 7123725 bp
Length : 699 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACGATTCTGATCGCCGACGACGATCCCGTCGTCCGGGACGTGGTCCGCCGCTATCTCGAGCGCGACGGCCACGAGGT
GCGCGAAACTGCAGACGGCACAACCACTGTGGCGGCGCTGGCGAATCCGGACGAGGTGATCGAGCTGGCCGTGCTCGACG
TGATGATGCCCGCGCCGGACGGCATCGAGATCTGCCGCGGCATCCGCTCGGGGCCGCGACCGGACATGCCGGTCATCCTG
CTCACCGCCCTCGGCGACGAGGACGACCGGGTACTCGGTCTGGAGGCGGGCGCCGACGACTACGTCACCAAGCCGTTCAG
CCCACGGGAACTCGCGCTGCGGGTCGCCTCGGTGCTGCGGCGCTCACAGGTGGTGCGCGACAGCGACCACCCGGTGCTGC
GCGACGGCGCCGTGGAGATCCGCCCGGCGGTCCGGCTCGTCCTCGTCGCCGGAGTGCCCGTGGATCTGACGCCGCGCGAG
TTCGACCTGCTCGTCTTCCTACTGCAGCATCCGCAGCAGGTGTTCAGCCGGGAAGCCTTGCTCGCCAAGGTCTGGGGCTG
GGATTTCGGCGACCTGTCCACAGTCACCGTGCACATCAAGCGGTTGCGCGCCAAACTCGGCGACAGCCATCGCATCGAAA
CCGTGTGGGGCCGCGGTTACGCGTGGGCGCGCACCGGGAACGGAGCCGTCGATGCCTGA

Protein sequence :
MTILIADDDPVVRDVVRRYLERDGHEVRETADGTTTVAALANPDEVIELAVLDVMMPAPDGIEICRGIRSGPRPDMPVIL
LTALGDEDDRVLGLEAGADDYVTKPFSPRELALRVASVLRRSQVVRDSDHPVLRDGAVEIRPAVRLVLVAGVPVDLTPRE
FDLLVFLLQHPQQVFSREALLAKVWGWDFGDLSTVTVHIKRLRAKLGDSHRIETVWGRGYAWARTGNGAVDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-26 45
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 3e-26 44
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 3e-26 44
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 3e-26 44
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 3e-26 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_031460 YP_006811215.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-26 44
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-37 43
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-37 43
O3I_031460 YP_006811215.1 two component transcriptional regulator CP001138.1.gene4273. Protein 6e-22 43
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-37 42
O3I_031460 YP_006811215.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-21 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-30 42
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_002695.1.915041.p Protein 1e-21 42
O3I_031460 YP_006811215.1 two component transcriptional regulator BAC0533 Protein 7e-22 42
O3I_031460 YP_006811215.1 two component transcriptional regulator CP000034.1.gene3834. Protein 1e-21 42
O3I_031460 YP_006811215.1 two component transcriptional regulator CP000647.1.gene4257. Protein 7e-22 42
O3I_031460 YP_006811215.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-34 41
O3I_031460 YP_006811215.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-35 41
O3I_031460 YP_006811215.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-24 41
O3I_031460 YP_006811215.1 two component transcriptional regulator BAC0596 Protein 2e-24 41
O3I_031460 YP_006811215.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-24 41
O3I_031460 YP_006811215.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-24 41
O3I_031460 YP_006811215.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-24 41
O3I_031460 YP_006811215.1 two component transcriptional regulator BAC0039 Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_031460 YP_006811215.1 two component transcriptional regulator VFG1389 Protein 1e-24 42
O3I_031460 YP_006811215.1 two component transcriptional regulator VFG1702 Protein 9e-31 41