Gene Information

Name : O3I_016415 (O3I_016415)
Accession : YP_006808218.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3661283 - 3661948 bp
Length : 666 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
GTGTTGGTGGTCGACGACGAGGACTCGGTCCGCGAGGCCCTGGTGCGCGCCATGGACAGCGAAGGCTACGAGACCCGAGC
CGCCGCGGACGGCGCGGCCGCGCTCGCCGAGATCCAGCGCTGGCAGCCGGAGGTCGTGCTACTGGACGTGCTGATGCCGT
TCATGGACGGCCTCACCGCGTGCCGGAGGTTGCGGGCACGGGGCGACCGCACGCCGATCCTGATGCTCACCGCGCGGGAC
GCGGTGGCCGACCGGGTCGACGGGCTCGACGCCGGTGCCGACGACTACCTGGTGAAACCGTTCGACCTCGAGGAGCTGCT
GGCCCGGGTGCGCGCGCTGGTCCGGCGCACCTATCCGGAGGACGGCGCGGTGCTGTCGTGTGCGGACCTCGTCATGGACA
CCACCGCGCACACGGTCCGGCGCGGTACCCGCCCGGTGGAGCTCAGCCGCACCGAATTCGCGTTGCTCGAAGTGCTGCTG
CGCAACAGCGGCCAGGCGCTGCCCCGCGAGACGCTCATCGAACGGGTCTGGGGCACCGAACTCGGGCCGACCTCGAATTC
GCTCGAGGTCTACATCCGCTATCTGCGCCGCAAACTCGAATCCGGCGACGAGCCGCGCCTGATCCACACCGTGCGCGGGA
TCGGCTATCGATTGGCGGCGGCATGA

Protein sequence : 
MLVVDDEDSVREALVRAMDSEGYETRAAADGAAALAEIQRWQPEVVLLDVLMPFMDGLTACRRLRARGDRTPILMLTARD
AVADRVDGLDAGADDYLVKPFDLEELLARVRALVRRTYPEDGAVLSCADLVMDTTAHTVRRGTRPVELSRTEFALLEVLL
RNSGQALPRETLIERVWGTELGPTSNSLEVYIRYLRRKLESGDEPRLIHTVRGIGYRLAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-26 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-25 45
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-17 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_016415 YP_006808218.1 two-component system response regulator BAC0197 Protein 2e-28 49
O3I_016415 YP_006808218.1 two-component system response regulator BAC0083 Protein 2e-28 48
O3I_016415 YP_006808218.1 two-component system response regulator BAC0125 Protein 3e-30 42
O3I_016415 YP_006808218.1 two-component system response regulator BAC0638 Protein 2e-19 42
O3I_016415 YP_006808218.1 two-component system response regulator HE999704.1.gene1528. Protein 9e-32 41
O3I_016415 YP_006808218.1 two-component system response regulator BAC0308 Protein 2e-31 41
O3I_016415 YP_006808218.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-30 41
O3I_016415 YP_006808218.1 two-component system response regulator Y16952.3.orf35.gene. Protein 5e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_016415 YP_006808218.1 two-component system response regulator VFG1390 Protein 4e-44 56
O3I_016415 YP_006808218.1 two-component system response regulator VFG0596 Protein 1e-26 46
O3I_016415 YP_006808218.1 two-component system response regulator VFG1386 Protein 1e-31 41