Gene Information

Name : AMBAS45_11380 (AMBAS45_11380)
Accession : YP_006803222.1
Strain : Alteromonas macleodii Balearic Sea AD45
Genome accession: NC_018679
Putative virulence/resistance : Resistance
Product : MarR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2653626 - 2654009 bp
Length : 384 bp
Strand : +
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGTATACAATCAGTAAACTCGCCAAAGAGGCAAATGTTGGTGTAGAGACCGTTCGTTTCTATGAACGCAAAGGCTTACT
TGAACAACCCATCAAACCGATACAGGGATACAGGCAATATACAGAACAAGCACTTTCAAGACTATTGTTCATAAAGCGTG
CACAGTATTTAGGTTTTACATTGGCGGAAATATCATCATTATTAATATTAAGTGCTAGTAATTGTGAAGATGTTCAGCAA
CTCGCTGAGCAAAAGCTTGCAGTAATTGAAGATAAGTTAAGAGATTTGCTTAACCTTAAAGACAGCCTTGTCTCGCTCAT
TTCAGACTGTAAAACTAATCCAAGTGATAAAGATTGCCCAATCATTCAGTCACTTCAACCGTAA

Protein sequence :
MYTISKLAKEANVGVETVRFYERKGLLEQPIKPIQGYRQYTEQALSRLLFIKRAQYLGFTLAEISSLLILSASNCEDVQQ
LAEQKLAVIEDKLRDLLNLKDSLVSLISDCKTNPSDKDCPIIQSLQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-25 48
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-20 43
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-19 41
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-19 41
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-19 41
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-19 41
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-19 41
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-19 41
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-20 41
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMBAS45_11380 YP_006803222.1 MarR family transcriptional regulator BAC0232 Protein 4e-20 41
AMBAS45_11380 YP_006803222.1 MarR family transcriptional regulator BAC0687 Protein 4e-20 41
AMBAS45_11380 YP_006803222.1 MarR family transcriptional regulator BAC0683 Protein 2e-20 41
AMBAS45_11380 YP_006803222.1 MarR family transcriptional regulator BAC0686 Protein 2e-20 41
AMBAS45_11380 YP_006803222.1 MarR family transcriptional regulator BAC0688 Protein 6e-21 41