Gene Information

Name : C270_07090 (C270_07090)
Accession : YP_006796326.1
Strain : Leuconostoc carnosum JB16
Genome accession: NC_018673
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1493307 - 1494014 bp
Length : 708 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGTAAAGTTTTGGTTGTGGATGATGAGAAGCCAATCTCAGATATCATTAAATTCAATCTTACAAAAGAAGGCTATGA
TGTTATTACAGCCGCAGATGGTCGGGAGGCGCTAGATATGTTTAGCGAAGAAAATCCTGATTTAGTTTTGTTAGATCAGA
TGTTACCAGAAATTGATGGTGTCGAAGTTTTGCGACAAATTCGTTCAAAGTCCGAAATTCCTGTCATTATGGTTACTGCT
AAAGATTCTGAAATCGATAAAGTTTTGGGATTGGAGATGGGTGCAGACGATTATGTGACTAAACCATTTTCAAATCGTGA
ATTAGTGGCACGAGTTAAGGCTAATTTGCGGAGCCGTAAAGCTGTAGCTCAGCATGGCGATGAGAGTGTTGTCAGCACTG
AGGATATTGAGTTGGGTGATTTGGTTATCCATCCACAAGCTTACATGGTTTCTAAATCCGGTCAAGATATTGAATTAACA
CATCGCGAGTTTGAACTACTTTACTATTTGGCACAACATATCGGTCAGGTCATGACACGAGAGCATTTGTTGCAACAAGT
TTGGGGTTATGATTATTTTGGTGATGTCCGTACGGTAGATGTGACAGTCCGCCGTTTACGTGAAAAAATTGAAGATAATC
CAAGTCATCCAAATTGGCTAGCGACACGTCGTGGCGTTGGTTACTATTTACGTCCTGATGCAGAATAG

Protein sequence :
MSKVLVVDDEKPISDIIKFNLTKEGYDVITAADGREALDMFSEENPDLVLLDQMLPEIDGVEVLRQIRSKSEIPVIMVTA
KDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRSRKAVAQHGDESVVSTEDIELGDLVIHPQAYMVSKSGQDIELT
HREFELLYYLAQHIGQVMTREHLLQQVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWLATRRGVGYYLRPDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C270_07090 YP_006796326.1 two-component response regulator NC_012469.1.7685629. Protein 2e-70 67
C270_07090 YP_006796326.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator HE999704.1.gene2815. Protein 2e-47 50
C270_07090 YP_006796326.1 two-component response regulator NC_012469.1.7686381. Protein 2e-42 47
C270_07090 YP_006796326.1 two-component response regulator AE016830.1.gene1681. Protein 3e-43 45
C270_07090 YP_006796326.1 two-component response regulator AE000516.2.gene3505. Protein 2e-34 45
C270_07090 YP_006796326.1 two-component response regulator NC_002695.1.915041.p Protein 7e-34 44
C270_07090 YP_006796326.1 two-component response regulator CP000034.1.gene3834. Protein 7e-34 44
C270_07090 YP_006796326.1 two-component response regulator CP001138.1.gene4273. Protein 5e-33 43
C270_07090 YP_006796326.1 two-component response regulator CP001918.1.gene5135. Protein 1e-28 43
C270_07090 YP_006796326.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-37 43
C270_07090 YP_006796326.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-38 43
C270_07090 YP_006796326.1 two-component response regulator BAC0533 Protein 2e-33 42
C270_07090 YP_006796326.1 two-component response regulator CP000647.1.gene4257. Protein 2e-33 42
C270_07090 YP_006796326.1 two-component response regulator AF162694.1.orf4.gene Protein 6e-33 42
C270_07090 YP_006796326.1 two-component response regulator AE015929.1.gene1106. Protein 9e-32 42
C270_07090 YP_006796326.1 two-component response regulator HE999704.1.gene1528. Protein 6e-32 41
C270_07090 YP_006796326.1 two-component response regulator CP004022.1.gene3215. Protein 3e-37 41
C270_07090 YP_006796326.1 two-component response regulator AM180355.1.gene1830. Protein 2e-37 41
C270_07090 YP_006796326.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-34 41
C270_07090 YP_006796326.1 two-component response regulator NC_011586.7046392.p0 Protein 1e-23 41
C270_07090 YP_006796326.1 two-component response regulator NC_010410.6002907.p0 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C270_07090 YP_006796326.1 two-component response regulator VFG1389 Protein 2e-31 44
C270_07090 YP_006796326.1 two-component response regulator VFG1386 Protein 8e-32 42
C270_07090 YP_006796326.1 two-component response regulator VFG1563 Protein 2e-33 41
C270_07090 YP_006796326.1 two-component response regulator VFG1702 Protein 2e-33 41