Gene Information

Name : BUPH_05777 (BUPH_05777)
Accession : YP_006794292.1
Strain :
Genome accession: NC_018672
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1971815 - 1972501 bp
Length : 687 bp
Strand : +
Note : identified by sequence similarity; putative

DNA sequence :
ATGAAATTGCTGATTGTTGAAGACGAGCACAAGGTGGTGGACTACCTGCGCTCCGGTTTGACAGAGCAGGGTTGGGTCGT
GGATGTCGCTCTCGACGGCGAGGAAGGCATGCATCTGGCCACCGAGTTCGATTACGACGTCATCGTGCTCGACGTCATGC
TGCCCAAGCGCGACGGCTTTAGCGTGCTGAAGGCTCTGCGCATGCGCAAGTCGACGCCGGTCATCATGCTCACCGCGCGC
GATCATGTGAACGACCGCGTGCGCGGCCTGCGCGAAGGCGCGGACGACTACCTCACCAAACCTTTCTCCTTCCTCGAACT
GGTCGAACGCCTGCACGCGCTCGCGCGCCGCACGCGGTCGCAGGAATCCACGCTGATTTCGGTCGGCGATCTGTTTGTCG
ATCTGATCGGACGGCGCGCGACACGTGACGGCGTGCGGCTCGATTTGACCGCGAAAGAATTCCAGTTGCTGAGCGTTCTG
GCCCGCAGGCAAGGCGACATTCTGTCGAAGACGGCCATCACCGAGCTGGTGTGGGACGTCAACTTCGACAGTCATACGAA
CGTGGTGGAGACGGCCATCAAACGATTGCGCGCGAAGCTGGACGGCCCGTTTCCGTCGAAGCTGCTGCATACCGTGCGCG
GCATGGGTTACGTGCTCGAAGTGCGTGAAGAGGCGGAGCCGTCATGA

Protein sequence :
MKLLIVEDEHKVVDYLRSGLTEQGWVVDVALDGEEGMHLATEFDYDVIVLDVMLPKRDGFSVLKALRMRKSTPVIMLTAR
DHVNDRVRGLREGADDYLTKPFSFLELVERLHALARRTRSQESTLISVGDLFVDLIGRRATRDGVRLDLTAKEFQLLSVL
ARRQGDILSKTAITELVWDVNFDSHTNVVETAIKRLRAKLDGPFPSKLLHTVRGMGYVLEVREEAEPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-49 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-48 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0197 Protein 1e-58 57
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0083 Protein 1e-52 55
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0125 Protein 2e-58 55
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0638 Protein 1e-44 51
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0111 Protein 6e-53 51
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0308 Protein 7e-53 50
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0347 Protein 1e-46 47
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR CP000675.2.gene1535. Protein 1e-31 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002952.2859905.p0 Protein 1e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002758.1121668.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007622.3794472.p0 Protein 1e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_009641.5332272.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_013450.8614421.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007793.3914279.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002745.1124361.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_009782.5559369.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002951.3237708.p0 Protein 2e-32 41
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_003923.1003749.p0 Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG0596 Protein 1e-49 52
BUPH_05777 YP_006794292.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1389 Protein 5e-38 50