Gene Information

Name : Eab7_0323 (Eab7_0323)
Accession : YP_006790092.1
Strain : Exiguobacterium antarcticum Eab7
Genome accession: NC_018665
Putative virulence/resistance : Resistance
Product : metal-sensitive transcriptional repressor
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 331393 - 331656 bp
Length : 264 bp
Strand : +
Note : -

DNA sequence :
ATGGAAAAAGTATATGAAGACAAAATCATTCATCGGATGAACCGGATTGAAGGTCAGCTTCACGGCATTATCCGGATGAT
GAAAGAAGAAGCGTCCTGTAAAGATGTTGTCACTCAACTGAGTGCGACACGGAGCGCGATTGATCGCGTCATTGGACTTG
TCGTGAGTGAAAATCTCATCGACTGTGTCACGAATGACGAAACAGCCGATAATCACGAACAGTCTGTAGCAGAAGCCGTT
CAACTGTTATTGAAGAGCAGATAA

Protein sequence :
MEKVYEDKIIHRMNRIEGQLHGIIRMMKEEASCKDVVTQLSATRSAIDRVIGLVVSENLIDCVTNDETADNHEQSVAEAV
QLLLKSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAC57484.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 5e-21 50
SAV0048 NP_370572.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-21 50
unnamed BAA82210.2 - Not tested Type-II SCCmec Protein 5e-21 50
SA0045 NP_373285.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-21 50
SERP2514 YP_190056.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-21 50
unnamed BAB47614.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-21 49
SAR0047 YP_039520.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-21 49
unnamed BAA94324.1 hypothetical protein Not tested Type-I SCCmec Protein 7e-19 49
unnamed BAA82170.2 - Not tested Type-II SCCmec Protein 2e-19 49
SACOL0048 YP_184958.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-20 49
unnamed BAB83476.1 - Not tested SCC 12263 Protein 1e-18 48
unnamed BAA86632.1 hypothetical protein Not tested Type-I SCCmec Protein 8e-20 48
SAPIG0063 YP_005732873.1 conserved protein YrkD Not tested Type-V SCCmec Protein 2e-20 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_0323 YP_006790092.1 metal-sensitive transcriptional repressor BAC0333 Protein 8e-07 41