Gene Information

Name : Curi_c28350 (Curi_c28350)
Accession : YP_006789674.1
Strain : Clostridium acidurici 9a
Genome accession: NC_018664
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2988227 - 2988916 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGAATAGAAAGATTTTAGTAGTAGATGATGAGAAACCTATAGCAGATATACTAAATTTTAATTTAAAAAAAGAAGGATT
TGAGGTTATAACGGCTTATGATGGACAAAATGCAGTGAATAAGGCTTTGACAGATTGTCCAGACCTTATAATATTAGATG
TTATGTTGCCAGAGAAAGATGGATTTCAAGTTCTTAAAGAAATCAGACAACAAATTAAAGTTCCAGTAATTATGTTGACT
GCTAAAGAAGAGGAAGCAGACAAGGTTCTAGGACTAGAGTTAGGTGCAGATGACTATATGACGAAACCATTTGGAATGAA
GGAACTTGTAGCTAGAGTTAATGCTAATTTAAGACGTATAGAATATCTAACTACATCTAATAATAACGAATTAATAGTGT
CAGGTGACTTAGTTATAGATTTAAATAAATATGAGGTAACTAAGAGTGGAAAAATAATAGAACTTACACTAAGAGAGTAT
GAATTATTAAAGTTTTTAGCCACAAGATCGGAACAAGTATATACTAGAGAAAAACTTCTTGAAGAAGTATGGGGATATGA
GTATTACGGTGACATAAGAACTGTAGATGTAACTGTTAGAAGGCTTAGAGAGAAGGTAGAGGATGAATTAGGTGACTATA
AGTACATACTAACTAAAAGAGGTGTTGGATACTACTTTAGGGGGAACTAA

Protein sequence :
MNRKILVVDDEKPIADILNFNLKKEGFEVITAYDGQNAVNKALTDCPDLIILDVMLPEKDGFQVLKEIRQQIKVPVIMLT
AKEEEADKVLGLELGADDYMTKPFGMKELVARVNANLRRIEYLTTSNNNELIVSGDLVIDLNKYEVTKSGKIIELTLREY
ELLKFLATRSEQVYTREKLLEEVWGYEYYGDIRTVDVTVRRLREKVEDELGDYKYILTKRGVGYYFRGN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-35 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_012469.1.7685629. Protein 9e-59 57
Curi_c28350 YP_006789674.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-50 52
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-49 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-48 50
Curi_c28350 YP_006789674.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-39 46
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-37 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-44 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 1e-33 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 45
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-40 43
Curi_c28350 YP_006789674.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 3e-33 43
Curi_c28350 YP_006789674.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-36 43
Curi_c28350 YP_006789674.1 two component transcriptional regulator BAC0125 Protein 2e-33 43
Curi_c28350 YP_006789674.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-39 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator BAC0308 Protein 9e-32 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 7e-37 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-35 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator AM180355.1.gene1830. Protein 3e-36 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-41 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 7e-37 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator CP001918.1.gene5135. Protein 4e-25 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator NC_002695.1.915041.p Protein 5e-29 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator CP000034.1.gene3834. Protein 5e-29 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator BAC0638 Protein 2e-31 42
Curi_c28350 YP_006789674.1 two component transcriptional regulator AE015929.1.gene1106. Protein 4e-30 41
Curi_c28350 YP_006789674.1 two component transcriptional regulator HE999704.1.gene1528. Protein 9e-31 41
Curi_c28350 YP_006789674.1 two component transcriptional regulator BAC0083 Protein 1e-36 41
Curi_c28350 YP_006789674.1 two component transcriptional regulator CP004022.1.gene3215. Protein 3e-32 41
Curi_c28350 YP_006789674.1 two component transcriptional regulator BAC0533 Protein 1e-28 41
Curi_c28350 YP_006789674.1 two component transcriptional regulator CP000647.1.gene4257. Protein 1e-28 41
Curi_c28350 YP_006789674.1 two component transcriptional regulator CP001485.1.gene721.p Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Curi_c28350 YP_006789674.1 two component transcriptional regulator VFG1389 Protein 1e-31 43
Curi_c28350 YP_006789674.1 two component transcriptional regulator VFG0596 Protein 4e-36 41