Gene Information

Name : O3O_21100 (O3O_21100)
Accession : YP_006782699.1
Strain : Escherichia coli 2009EL-2071
Genome accession: NC_018661
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS3 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 921412 - 921798 bp
Length : 387 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGAAATACACGGTGGCAGATGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAACACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGT
AAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACTGTAGATTCAATCTGTCAATG
CAACACCCCTTTCAATTATCTCTTTCGGTGTTTTGAACTTCAGTGTCTTTCTCGGTCTGTTGTTTAG

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIR
KLRKKLQRIEMENEILKKATVDSICQCNTPFNYLFRCFELQCLSRSVV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-35 90
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-35 90
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-34 87
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-29 65
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 65
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 65
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 61
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-20 54
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-20 54
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-20 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-20 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-20 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-17 53
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-19 47
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 7e-19 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-11 44
Z1150 NP_286685.1 hypothetical protein Not tested TAI Protein 6e-17 41
Z1589 NP_287093.1 hypothetical protein Not tested TAI Protein 6e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3O_21100 YP_006782699.1 transposase ORF A, IS3 family protein VFG1485 Protein 4e-36 90
O3O_21100 YP_006782699.1 transposase ORF A, IS3 family protein VFG1123 Protein 5e-30 65
O3O_21100 YP_006782699.1 transposase ORF A, IS3 family protein VFG1553 Protein 5e-25 61
O3O_21100 YP_006782699.1 transposase ORF A, IS3 family protein VFG0784 Protein 6e-21 53
O3O_21100 YP_006782699.1 transposase ORF A, IS3 family protein VFG1566 Protein 6e-12 44