Gene Information

Name : O3O_21475 (O3O_21475)
Accession : YP_006782629.1
Strain : Escherichia coli 2009EL-2071
Genome accession: NC_018661
Putative virulence/resistance : Virulence
Product : antitoxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 852011 - 852388 bp
Length : 378 bp
Strand : -
Note : CP4-44 prophage

DNA sequence :
GTGTCAGACACACTCCCCGGGACAACGCCTCCCGACGACAATCACGACCGCCTCTGGTGGGGACTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGAAGGGTAACCGGTTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCGGT
TCAGCGATGCAGATGCATACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAGCTCATGCTCACCAGTGGT
GAACTGAATCCCCGCCATCAGCATACCATGACACTGTATGCGAAAGGGCTGACCTGCGAAGCCGACACCCTCGGCTCCTG
TGGTTACGTTTATCTGGCTGTTTATCCGACACCGGCAGCGCCCGCAACCACCGTATAA

Protein sequence :
MSDTLPGTTPPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTMTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 4e-46 98
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 2e-45 96
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 2e-45 96
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 4e-45 96
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 6e-45 96
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 6e-44 95
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 3e-45 95
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-44 95
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 6e-43 94
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 1e-43 93
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 1e-42 92
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-41 91
Z1220 NP_286755.1 structural protein Not tested TAI Protein 8e-42 91
Z1658 NP_287161.1 structural protein Not tested TAI Protein 8e-42 91
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 2e-41 88
unnamed AAL08477.1 unknown Not tested SRL Protein 5e-42 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3O_21475 YP_006782629.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG0662 Protein 5e-46 96
O3O_21475 YP_006782629.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1619 Protein 3e-44 95
O3O_21475 YP_006782629.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1681 Protein 1e-41 91
O3O_21475 YP_006782629.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1068 Protein 2e-42 88