Gene Information

Name : O3O_03315 (O3O_03315)
Accession : YP_006786200.1
Strain : Escherichia coli 2009EL-2071
Genome accession: NC_018661
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS911
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4597026 - 4597328 bp
Length : 303 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGCTCACCTCAGAACAACACAGGTGCCATAATGAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACT
GGTCGTTGACCAGAAATACACCGTGGCAGATGCAGCCAGCGCTATGGATGTCGGCCTTTCCACAATGACGCGATGGGTGA
AACAATTACGTGATGAGCGGCAGGGAAAAACACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGTGAGCTC
AGGAAAAAGCTACAACGTATTGAAATGGAAAATGAAATATTAAAAAGGCTACCGCGCTCTTGA

Protein sequence :
MLTSEQHRCHNEKRNFSAEFKRESAQLVVDQKYTVADAASAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIREL
RKKLQRIEMENEILKRLPRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-33 96
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-33 96
api80 CAF28554.1 putative transposase Not tested YAPI Protein 6e-33 95
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-32 93
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-26 73
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-26 73
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-26 73
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-26 73
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-26 73
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-26 73
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-26 73
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-26 73
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-23 64
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-18 55
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-18 55
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-18 54
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-17 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-18 49
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-18 49
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-18 49
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-18 48
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-17 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3O_03315 YP_006786200.1 transposase ORF A, IS911 VFG1485 Protein 5e-34 96
O3O_03315 YP_006786200.1 transposase ORF A, IS911 VFG1123 Protein 1e-26 73
O3O_03315 YP_006786200.1 transposase ORF A, IS911 VFG1553 Protein 6e-24 64
O3O_03315 YP_006786200.1 transposase ORF A, IS911 VFG0784 Protein 9e-19 49