Gene Information

Name : O3O_09790 (O3O_09790)
Accession : YP_006784917.1
Strain : Escherichia coli 2009EL-2071
Genome accession: NC_018661
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3207510 - 3208085 bp
Length : 576 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAGTTTCTCTCGTAAAAGGCGGCAACGTATCTCTGACCAAAGAAGCACCAACCATGAATGTCGCTATGGTTGGCCT
GGGCTGGGATGCCCGTGTAACCGATGGTCAGGGTTTTGATCTGGACGCTTCCGTATTCGCAGTAGGTGAAGACGGTAAAG
TACTGTCAGATGCCCATTTCATTTTCTTCAATAATAAAACCAGCCCTGATGGCGCAGTAGAGCACCAGGGCGACAACCGT
ACCGGTGAAGGCGACGGCGACGATGAGCAGGTCAAAATCGATCTGACCAAAGTCTCAGCAGACATCAAAAAACTGGTATT
TGCTGTTACCATCTATGATGCAGAAGCGCGTAAACAAAACTTCGGCATGGTGAGCAACAGCTTCATGCGCGTTTACAACA
ACGACAACGGGACGGAAATTGCCCGTTTCGATCTGTCTGAAGACGCCTCAACCGAAACCGCAATGGTCTTCGGTGAACTG
TATCGCCATGGTACTGAGTGGAAGTTTAAAGCTGTTGGCCAGGGTTTTGCCGGTGGTCTGTCAGCGCTTGCTTCCCAGCA
CGGCGTCAATGTCTAA

Protein sequence :
MAVSLVKGGNVSLTKEAPTMNVAMVGLGWDARVTDGQGFDLDASVFAVGEDGKVLSDAHFIFFNNKTSPDGAVEHQGDNR
TGEGDGDDEQVKIDLTKVSADIKKLVFAVTIYDAEARKQNFGMVSNSFMRVYNNDNGTEIARFDLSEDASTETAMVFGEL
YRHGTEWKFKAVGQGFAGGLSALASQHGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-84 100
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-65 72
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-58 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3O_09790 YP_006784917.1 tellurium resistance protein TerE BAC0390 Protein 1e-78 87
O3O_09790 YP_006784917.1 tellurium resistance protein TerE BAC0389 Protein 2e-58 65